KEGG   Flavobacterium gilvum: EM308_01335Help
Entry
EM308_01335       CDS       T04609                                 

Definition
(GenBank) glycoside hydrolase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00052  Galactose metabolism
fgl00511  Other glycan degradation
fgl00600  Sphingolipid metabolism
fgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgl00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EM308_01335
  Lipid metabolism
   00600 Sphingolipid metabolism
    EM308_01335
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EM308_01335
Enzymes [BR:fgl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EM308_01335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_N Glyco_hydro_2_C DUF4982 Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AOW08262
UniProt: A0A085EJK3
LinkDB All DBs
Position
complement(277568..279982)
Genome map
AA seq 804 aa AA seqDB search
MVKKTGIVLVLLLSIASFSQTKKARIVEDFNKNWNFKLGDYPQAINANFNIADWRTLNLP
HDWSIEGAFDKDSKTKQAQGFLPAGKGWYRKVFTIPANWKNKAISIEFDGVFKNSEVFIN
GHSLGIRPNGYISFGYELSQYLYFGKPNVIAVKVDNDAQPNSRWYTGSGIYRNVRLVVSE
KLHVAKWGTYVTTPEVSAQKASVNCEVTIDNENASAKEFKLVTSIVNANNVEVANSTSIE
KFEPKTSAKKVHNLTVNQPKLWDTENPYMYKVLTRIYENSKLIDNYETPLGFRFFSFDAE
KGFSLNGKPTKILGVCLHHDNGALGAVENIHAVKRKLKILKEMGANAIRMAHNPHSLEMM
QLCDEMGFIVQDEAFDVWKKKKVTNDYHKDWDAWHKQDLEDFIKRDRNHPSVMMWSIGNE
IREQFDSTGIAITRELAQIVKSLDKTRPVTSALTENVIEKNFIYQSGALDLLGFNYKHED
YKDFPVRFKGQKILASESVSALETRGHYDQPSDVIKTWPPKYGAPFDGNADWTVSAYDQV
KSYWGATHEDNWKTIKKQDFMAGTFIWTGFDYIGEPDPYPYPARSSYFGIIDLAGFPKDV
YYMYQSEWTTKPVLHIFPHWNWTAGQEVDVWAYYNNADEVELFLNGKSLGKKSKQNDDLH
ISWRVKFEPGTIKAISRKGGKVVLEKEIKTAGEASKIALVANKKTLKNDSYDLVYVTVSI
TDKDGNLVPNANNLIDFEVIGGGKLVGVDNGYQAGWDSFKANSCKVFNGKCIAIIQSNGK
KENIQLKASTGIDILAKAIEIKVE
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaaacaggaatcgtattggtattattgctttcaatagcaagtttttcccaa
actaaaaaagcccgaatcgttgaggattttaataaaaactggaattttaaactaggggat
tatcctcaggcaataaatgctaatttcaatatcgctgattggagaactttgaatttgcct
cacgattggagcattgaaggagcatttgataaagacagtaaaacaaaacaagcgcaagga
ttcttgccagctggaaaaggttggtaccgcaaagtttttaccattcctgccaattggaaa
aacaaagccatttcaatcgaatttgatggtgttttcaaaaacagtgaagtattcataaat
ggacattcgttgggaattcgcccgaacggatatatttctttcggttatgaattatcccaa
tatttgtattttggaaaaccaaatgttatcgctgtcaaagttgataatgatgcgcagccc
aattcaagatggtacacgggatcgggaatttacagaaatgtgcgattagttgtcagcgag
aaactgcacgtggccaaatggggaacttatgtaacgactccggaggtttctgcacaaaaa
gcaagcgttaattgtgaggttactattgacaatgaaaacgcttccgcaaaagaattcaaa
ctggtaacttcaatagtaaatgcaaacaatgttgaggttgcaaacagcacttctatagaa
aaatttgagccaaaaacttctgcaaaaaaggttcataatttaaccgttaatcagccaaaa
ttatgggatactgaaaatccatatatgtacaaagtgctgacgagaatctatgaaaattca
aaattaatcgacaattatgaaactccattgggtttccgattcttcagttttgatgccgaa
aaaggattttcattgaatggaaaaccaacaaagatattaggcgtttgtctgcatcacgac
aacggcgctttgggggctgtggaaaatattcacgccgtaaaaagaaaactgaaaatcctg
aaagaaatgggagctaatgccatccgaatggcacataatccacattcgttggaaatgatg
cagttgtgcgacgagatgggatttattgttcaggacgaagcttttgatgtttggaaaaag
aaaaaagtaaccaacgattaccacaaagattgggatgcgtggcacaaacaggatttggaa
gattttatcaaaagagaccgcaaccatccgtcggtgatgatgtggagtatcggaaatgaa
atccgtgagcaatttgacagcaccggaattgcgattactagagaattggcacaaattgtt
aaatcgctagacaaaacgcgtcccgtaacgagcgctttgactgaaaatgttattgagaaa
aattttatttaccaatcgggtgctttggatttgttgggattcaattataaacacgaagat
tacaaagattttccagttcgtttcaaagggcaaaagatactcgcttccgagagtgtttcg
gcgctcgaaacccgtggacattatgaccaaccttcggatgtgataaaaacttggccaccc
aaatatggtgctccgtttgatggcaatgccgattggactgtttcggcttacgatcaggtg
aaatcctattggggagcgactcacgaagacaattggaaaaccatcaaaaaacaggatttt
atggcgggaactttcatctggacaggattcgattatattggggaacccgatccgtatcct
tatcctgcaaggagttcgtacttcggaattattgatttggctggctttcccaaagatgtg
tattatatgtaccaaagtgaatggacgaccaaacccgttttgcatatttttcctcactgg
aattggacggctggacaggaagtcgatgtttgggcgtattacaacaatgccgatgaagtc
gaattgttccttaacggaaaatcattgggtaaaaaatccaagcaaaatgacgatttacac
atttcatggcgtgtaaaattcgaacccggaacaataaaagccatttctagaaaaggggga
aaagttgttttggaaaaagaaatcaaaacagctggagaagcttcgaaaattgctttagta
gccaacaagaaaaccctgaaaaatgacagttatgatttggtttacgtaaccgtttctata
actgataaagacggaaacttagtgccaaacgccaataatctaatcgattttgaagtgata
ggtggcggaaaattagttggagttgacaatggttatcaggcaggttgggattcgttcaaa
gccaattcttgcaaagtatttaatggtaaatgtatcgccattattcaatctaacggaaag
aaagaaaatattcagttaaaagcttcaacggggatcgatattttggcgaaagccatagaa
ataaaagtggaatag

DBGET integrated database retrieval system