KEGG   Flavobacterium gilvum: EM308_02800Help
Entry
EM308_02800       CDS       T04609                                 

Definition
(GenBank) bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00473  D-Alanine metabolism
fgl01100  Metabolic pathways
fgl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EM308_02800
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    EM308_02800
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fgl01011]
    EM308_02800
Enzymes [BR:fgl01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     EM308_02800
Peptidoglycan biosynthesis and degradation proteins [BR:fgl01011]
 Precursor biosynthesis
  Racemase
   EM308_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase
Motif
Other DBs
NCBI-ProteinID: AOW08511
UniProt: A0A085EG83
LinkDB All DBs
Position
complement(644819..647293)
Genome map
AA seq 824 aa AA seqDB search
MNLSLKKIISILNTQEIGTPDDLTIDNISIDSRSLQNNDKTLFFALVGNNNDAHIYIKDL
MLKGVRNFVVTHIPEGLEGKANFLVVKNTLEALQQVAAYYRSLFAFPIIGVTGSNGKTIV
KEWLNFLLSPDYNIIRSPKSYNSQVGVPLSVLAINEQHNLGIFEAGISTVSEMDKLEKII
QPTIGILTNIGSAHDEGFESTEEKIKEKMLLFQHSKVVIFQKNELVDKCLESFSGYIPPS
GAREIFSWSFTDNSATVFVSKKEHTHENIHIEYTYKGNVSDLKIPFVDDASVENVISCLS
VLLYLEYDEKTIQNRIELLYPMEMRLKVKKGINNCSLIDDSYSSDFQSLKIALDFLESQK
QHQKKTVVLSDIFQSGLSNEVLYSKVAELIVSNDINRVIGIGDTISILKTKLPNAVFFKD
TNEFLVQLEQLNFENETILIKGARSFQFEEIVSALTEKTHETVLEINLNAISHNYNFFKS
KLKPTTKMMAMVKAFGYGSGGFEIAKLLEHHKLDYLGVAFADEGISLKTAGIKLPIMVLN
PENTSFSAIIQHQLEPEIYSLKGLNAFLKIAEQKKLKDFPIHIKMDTGMHRLGFEANTID
DLIATLKGNQTVKVKSILSHLATSDDLQHKDFVYYQINLFEKLSSKLMTELAINPIRHIL
NTSGISNFPEAQYDMVRLGIGLYGVSNDSEEQKYLENVGTLKSVISQIRTIQSGESVGYG
RRFMANRESRIATIPIGYADGISRHWGNGIGFVTIKNKKAPVLGSVCMDMLMVDVTEIDC
KEGDSVVIFGESPTVSYMAEQLKTIPYEILTSISQRVKRVFYRE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatccctaaaaaaaatcatttcaattcttaatacccaagaaattggaacacca
gatgatttaacaatcgacaacatttccatcgacagccgttctttgcaaaataatgacaaa
acgcttttttttgcattggtcggaaacaataatgacgcccatatttacataaaagatttg
atgctcaaaggagttcgtaattttgtggtaactcatattcccgaaggtctcgaaggcaaa
gccaattttttggttgtcaaaaacactttggaagccttacagcaagttgcggcgtattac
cgaagtctttttgcctttccgattattggagtaacgggaagtaacggaaaaacaatcgta
aaggaatggctcaatttcttgttgagtcccgattataatattatccgaagtccaaagagt
tataattctcaggttggggttccgttgtcggtgctcgctataaatgaacaacataatctt
gggatttttgaagccggaatttcgactgtttccgaaatggataaattggaaaaaatcatt
caacctacgattgggattttaaccaatatcggttctgcccacgatgaaggttttgaaagc
accgaggaaaaaatcaaagaaaaaatgctgcttttccaacattctaaagtagtaattttt
caaaaaaatgaattggtagataaatgtttggaatcttttagcggttatattcccccttcg
ggggctagggagattttttcttggtcttttacggataattctgcgacagtttttgtttcc
aaaaaagagcatactcacgaaaatatacatattgaatatacatataaaggaaacgtttcg
gacttgaaaattccttttgtggatgatgcttcagtcgaaaacgtgatttcctgtttatca
gttttactgtatttggaatatgatgaaaaaacgattcagaatcgaattgaattgttgtat
ccaatggaaatgcgtttgaaagtaaaaaaaggaatcaacaattgcagtttgattgatgat
agttatagttccgattttcagtctttgaaaattgccttggattttctcgaaagccaaaaa
cagcatcagaaaaaaacagtagtgctgtctgatatttttcagagcggattgtctaacgaa
gtattgtattctaaagtagccgagttgattgtttccaacgatatcaaccgtgtaattggg
attggagatacgatttctatattgaaaacaaaacttccgaatgctgtttttttcaaagac
actaacgaatttttagtgcaattggagcaattaaattttgaaaacgaaacgattttgata
aaaggagcaagatcgttccaatttgaagaaatagtgtcggcgctgactgagaaaactcac
gaaaccgttcttgaaatcaatctgaacgcaattagtcataattataacttctttaaatca
aaactaaaaccaacaaccaaaatgatggcgatggtcaaagcgtttggttatggaagcggt
ggatttgaaattgcaaaattgctggaacatcacaaactagattatctcggagtggctttc
gccgatgaaggaatttcgctgaaaacggccggaatcaaattgccaattatggttttgaat
cctgaaaatactagcttttcggctatcattcagcatcagttggaaccggaaatttacagt
ctgaaaggattgaatgcgttccttaaaattgccgaacaaaagaaattaaaagactttcct
attcatataaagatggataccggaatgcaccgtctcggttttgaggccaatacgatagat
gatttaatcgccactttgaaaggaaatcaaaccgtcaaagtgaagagtattctgtctcat
ttggcgacaagcgatgacttgcaacacaaagatttcgtatattatcaaataaatttattc
gaaaaattatcttctaaattaatgaccgaattggcgattaacccgattcgccatattttg
aacacttccggcatcagtaattttcccgaggcgcaatatgatatggttcgtttgggaatt
ggtctttatggcgtttccaatgattcggaggaacaaaaataccttgaaaacgtaggaaca
ttaaaatcagttatttctcagattagaacgattcaatccggagaaagcgttggttacggc
agacgatttatggcaaacagagaatcgagaattgccacaatcccgataggttacgccgac
ggaatttcgagacattggggaaatggcattggatttgtaaccattaaaaacaaaaaagca
cctgttcttggaagtgtttgcatggatatgctaatggtagatgtaaccgaaattgactgc
aaagaaggagactcggttgttatttttggcgaaagcccaaccgtttcctatatggcagaa
caattgaaaaccattccgtatgaaattttgaccagtatatctcaaagggttaagagagtt
ttttatagggagtag

DBGET integrated database retrieval system