KEGG   Flavobacterium gilvum: EM308_02825Help
Entry
EM308_02825       CDS       T04609                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00240  Pyrimidine metabolism
fgl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    EM308_02825
Enzymes [BR:fgl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EM308_02825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22
Motif
Other DBs
NCBI-ProteinID: AOW08516
UniProt: A0A085EG89
LinkDB All DBs
Position
complement(650183..650776)
Genome map
AA seq 197 aa AA seqDB search
MFLENTVNHKEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDTRYHEEM
VVSHDSNEIRSTPVPAAANIAILAQGCDVVGIDEAQFFDDEIVTVCNDLANQGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLANYSFRKSDNDKLVMLGETDEYEP
LSRAAYYHAMRKDEESK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaacacagtaaatcataaagagcagtttggttggattgaagtcatttgt
ggctcaatgttttcgggaaaaaccgaagaactcattcgtaggctgaaaagagcgcaattt
gccaaacaaaaagttgaaattttcaaacccgcaatcgatacccgctaccacgaggaaatg
gtggtgtctcacgacagtaacgaaattcgctctacgcctgttcccgcagcggccaatatt
gctattttggcgcaaggctgtgatgttgttggaattgatgaagcgcagttttttgatgac
gaaatagtaacggtttgcaacgaccttgccaatcagggaattcgtgttattgttgccggt
ttggacatggatttcaaagggaatccttttgggccaatgcctgcgcttatggctacagcc
gagtatgttaccaaagtgcacgccgtgtgtacgcgaaccggaaatttggcgaattacagt
tttagaaaaagcgacaacgataaactcgtaatgctaggtgaaactgatgaatatgagcca
ttgagccgcgccgcttattatcacgcaatgcgaaaagatgaagaatcaaaataa

DBGET integrated database retrieval system