KEGG   Flavobacterium gilvum: EM308_07215Help
Entry
EM308_07215       CDS       T04609                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00564  Glycerophospholipid metabolism
fgl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EM308_07215
Enzymes [BR:fgl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EM308_07215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Thi4 FAD_binding_3 HI0933_like Pyr_redox_2 NAD_binding_8 Pyr_redox_3 Lycopene_cycl DUF3290
Motif
Other DBs
NCBI-ProteinID: AOW09314
UniProt: A0A085EK15
LinkDB All DBs
Position
complement(1717564..1719144)
Genome map
AA seq 526 aa AA seqDB search
MNRIEQLEKLKQNQIWDIIIIGGGANGLGVAVDAASRGFKTVLLEAVDFAKGTSSRSTKL
AHGGVRYLEQGNISLVIEALRERGLMEKNAGHLVKNESFVIPNYNWWGGYFYTFGLKLYD
LLAGKLSLGSSKYLSKEKTLALIPSIEPNGLQSGVLYHDGQFDDSRLAINLAQTAVEKGA
CVLNHIKVTQLLKNDKKQITGVAAVDQISNEEYTLQGKTVINATGVFTNAIMKMNDSVYK
KYIVPSQGIHLVFDKSFLPGEHALMIPKTSDGRVLFAVPWHDKIVVGTTDTLVKKSDIEP
IALEEEIEFVLKTAQKYLTKDPTRADVLSVFAGLRPLAAPEKKGQATKEVSRSHKIIVSK
TGLITVTGGKWTTYRQIAEEIVNKAIETHQLSPYKCITQHLPIHGNKKNSEADFQNHLFV
YGTDSSAILKLQENDPSLKEKLHPDYNYTLAEVVWAIREEMAITVEDVLARRVRLLFLDA
RAAISCADKVARIMAKELGHDEIWIQNQLVDFKAVANGFLLKEFRI
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgaatcgaacagctggaaaaactcaaacaaaaccaaatttgggacatcattatt
ataggaggaggtgccaacggactcggtgttgctgttgatgccgcgagcagaggttttaaa
acagttcttctcgaagccgtagattttgccaagggtacttctagccgaagcacaaaattg
gctcacggcggggtccgctatttagagcagggaaatatttctttggtcattgaagctctt
agagaaagagggttgatggagaaaaacgcagggcatttggtaaaaaacgaatctttcgtt
atcccgaattacaactggtggggcgggtatttttatacatttggtttaaaattatacgat
ttactcgccggaaaactaagtcttgggagttccaaatatctatccaaagaaaaaactttg
gccttaattccgtcaattgaaccgaatggattgcaaagcggcgttctgtatcacgacggg
caatttgacgattcccgtttggccataaatcttgcccaaactgctgtcgaaaaaggagcc
tgtgtactcaatcatattaaagtcacgcaattattaaagaacgacaaaaaacaaattact
ggagttgcagccgtagaccagatatccaacgaagaatatactttgcaaggcaaaacggta
ataaatgcgacgggggtttttaccaatgccattatgaaaatgaacgatagtgtttataaa
aaatatatagttcccagtcaaggcattcatttggtttttgacaaatcctttttacccggc
gaacatgcattgatgattcccaaaacgagtgacggaagggttctttttgcagttccatgg
cacgacaaaattgttgtgggcacaacggatactttggtaaaaaagtcagatattgaacca
attgcccttgaagaagaaatcgaatttgtactgaaaacagctcaaaaatacctgaccaaa
gatccgacacgagccgatgtgctttcggtttttgcgggactaaggcctttggccgctcca
gagaaaaaaggccaagccacaaaagaagtttccagaagccacaaaataatcgtttccaaa
acaggcttaatcaccgtcaccggcggaaaatggacaacctatcgacaaattgccgaagaa
atagtcaacaaggcaattgaaacacaccaactaagtccttataaatgtataacgcaacat
ttgcctattcacggaaacaagaaaaatagtgaagctgattttcaaaatcaccttttcgtt
tacgggactgacagtagtgcaattttgaaattacaggaaaacgatccctccctaaaagaa
aaattacaccccgactataattatactttggctgaagtcgtttgggccatccgggaagaa
atggctattactgttgaagatgttttggcgagacgcgttcggctgctattcctggatgcg
cgagccgcaatttcctgcgccgataaagtggcacgtataatggcaaaagaattaggtcat
gatgaaatttggattcagaatcaattagtggattttaaagctgtcgctaatggattttta
ttaaaagagttcagaatttag

DBGET integrated database retrieval system