KEGG   Flavobacterium gilvum: EM308_14935Help
Entry
EM308_14935       CDS       T04609                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
fgl  Flavobacterium gilvum
Pathway
fgl00061  Fatty acid biosynthesis
fgl00780  Biotin metabolism
fgl01100  Metabolic pathways
fgl01130  Biosynthesis of antibiotics
fgl01212  Fatty acid metabolism
Module
fgl_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:fgl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    EM308_14935
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    EM308_14935
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    EM308_14935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fgl01004]
    EM308_14935
Enzymes [BR:fgl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     EM308_14935
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     EM308_14935
Lipid biosynthesis proteins [BR:fgl01004]
 Fatty acid synthase
  Component type
   EM308_14935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2
Motif
Other DBs
NCBI-ProteinID: AOW10683
UniProt: A0A085EM82
LinkDB All DBs
Position
complement(3693592..3694398)
Genome map
AA seq 268 aa AA seqDB search
MYNLLKGKRGIIFGALDENSIAWKTAERVHAEGGIFVLTNAPAAMRLGNIDALADKIGCQ
IIPADATSVSDLELLVDKAVEILGGKIDFVLHSIGMSVNVRKGNHYTNQNYEFTEKGWNV
SAVSFHKLMQVLYKKDAMNEWGSIIALSYMAAQRVFPDYNDMADNKAFLESVARSFGYFF
GRDKKVRVNTISQSPTATRAGQGVKGFGGFIAFADKMSPLGNATAAECADYIIVMFSDLT
RKVTLQNLLHDGGFSNMGVSQEVMEMFE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtataatttattaaaaggaaaaagaggaattatttttggtgcattggatgaaaattca
attgcttggaaaacagccgaacgagttcatgctgagggcggaatattcgtattgactaat
gctcctgcagccatgcgattgggaaatattgatgccttggctgataaaattggatgccaa
attattcctgccgatgcaacatcggtttctgatttggaattattagtggataaagcggta
gaaattttgggaggaaaaattgatttcgtcctgcattctatcggaatgtctgtcaatgta
aggaaagggaatcattatacaaatcaaaactatgagttcacagaaaaaggttggaatgtt
tcagcggtttcttttcataaactaatgcaggttttgtataaaaaagatgccatgaatgaa
tggggaagtatcattgcactttcttatatggctgcccaaagggtatttccagattataat
gatatggcagataataaggcatttcttgaatcggttgcccgtagttttgggtatttcttt
ggaagggataaaaaagtgagagtcaataccatttctcaatctccaacggccactagagct
gggcaaggcgttaagggatttggcggttttattgctttcgcagataagatgtcgcctttg
ggaaatgcaactgcagcagaatgtgcagattatattattgttatgttttctgatttgact
agaaaggtgactttacaaaatttactgcatgatggaggattctcaaatatgggagttagc
caagaagtaatggaaatgtttgaatag

DBGET integrated database retrieval system