KEGG   Fusarium graminearum: FGSG_00500Help
Entry
FGSG_00500        CDS       T01038                                 

Definition
(RefSeq) hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr00010  Glycolysis / Gluconeogenesis
fgr00051  Fructose and mannose metabolism
fgr00052  Galactose metabolism
fgr00500  Starch and sucrose metabolism
fgr00520  Amino sugar and nucleotide sugar metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
fgr01130  Biosynthesis of antibiotics
fgr01200  Carbon metabolism
Module
fgr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fgr_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FGSG_00500
   00051 Fructose and mannose metabolism
    FGSG_00500
   00052 Galactose metabolism
    FGSG_00500
   00500 Starch and sucrose metabolism
    FGSG_00500
   00520 Amino sugar and nucleotide sugar metabolism
    FGSG_00500
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    FGSG_00500
Enzymes [BR:fgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     FGSG_00500
Membrane trafficking [BR:fgr04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    FGSG_00500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 23547988
NCBI-ProteinID: XP_011316174
UniProt: I1RAH1
LinkDB All DBs
Position
1
AA seq 492 aa AA seqDB search
MVGLGPRRPPSRKGSMADVPKDLAEEINKLENLFTVQPSKLKEITNHFVSELAKGLSVEG
GSIPMNPTWVMSYPDGYETGTYLALDMGGTNLRVCQITLTDEKSEFDIIQSKYRMPEELK
SGTSEELWEYIAECLYQFLETHHGDCTKLEKIPLGFTFSYPATQNYIDEGILQRWTKGFD
IDGVEGQNIVPMFEEALKTRGVPIKLAAIINDTTGTLIASAYTDTAMKIGCIFGTGCNAA
YMEDCGSIPKIADLNLPADLPMAINCEWGAFDNEHKVLPRTPYDVIIDKESPRPGQQAFE
KMIAGLYLGEIFRLILVDLHDNKSIHIFENQDIALLRKPYSLDASFLSAIEEDPWENLSE
TSDLFSKKLNLKCTQPELELIRRTAELIGTRAARLSACGVAAICKKKNYQSCHVGADGSV
FNKYPHFKERGAKALRDILDWPEKTNKKEEDPIEVLTAEDGSGVGAALIAALTLKRINEG
NMAGILHPENFK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggtcggtcttggtcctcgtcgccctccctcccgaaagggatccatggccgatgtcccc
aaggacctcgctgaagagatcaacaagctcgagaatctcttcaccgtacagcccagcaag
ctcaaggagatcaccaaccatttcgtttctgaactcgccaagggtctcagcgttgagggt
ggtagcattcctatgaatcctacctgggtcatgtcatacccggatggctatgaaaccggc
acctacctggccctcgacatgggcggcaccaacctgagagtgtgccagatcacacttact
gacgagaagtccgagttcgatatcatccagtccaagtaccgcatgcctgaggagctcaag
tctggcacctctgaggagctttgggagtacattgccgaatgtctctaccagttccttgag
acacaccacggagactgcacaaagttggagaagatccctctgggtttcacattctcgtac
cccgccacccagaactacatcgatgagggtatcctccagcgatggaccaagggcttcgac
attgacggtgtcgagggccagaacattgttcccatgttcgaggaggccttgaagactcgg
ggcgttcctatcaagcttgccgctatcatcaatgatactaccggcacattgattgcctct
gcctacaccgatactgccatgaagattggttgcattttcggcactggttgtaacgccgca
tacatggaagactgcggctcaatccccaagattgctgacctgaacctccctgctgacctg
cctatggccatcaactgcgaatggggagctttcgacaatgagcataaggtcctcccccga
accccctacgacgtcatcattgacaaggagtctcctcgccctggacagcaggcttttgag
aagatgattgctggtctgtaccttggcgagatcttccgactcattctcgtcgacctccac
gacaacaagtctatccatatctttgagaaccaagacattgctctcctccgcaagccttat
tctctggatgcctccttcctgtctgctatcgaggaggacccctgggagaacctgtccgag
accagcgacctcttcagcaagaagctgaacttgaagtgcacacagcctgagcttgagctt
atccgcagaaccgccgagctcatcggcacacgagctgcccgcctctcggcctgtggcgtt
gctgctatctgcaagaagaagaactaccaatcttgccacgtcggtgctgacggttccgtg
ttcaacaagtacccccacttcaaggagcgtggtgccaaggctctgcgagatattctcgac
tggcccgagaagaccaacaagaaggaagaggatcccattgaagtcctgactgccgaggac
ggtagcggtgtcggcgccgccctgattgccgccctgacgcttaagcgcatcaatgagggc
aacatggcgggtatccttcatcccgagaacttcaaataa

DBGET integrated database retrieval system