KEGG   Fusarium graminearum: FGSG_01572Help
Entry
FGSG_01572        CDS       T01038                                 

Definition
(RefSeq) glutamate decarboxylase 1
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
fgr  Fusarium graminearum
Pathway
fgr00250  Alanine, aspartate and glutamate metabolism
fgr00410  beta-Alanine metabolism
fgr00430  Taurine and hypotaurine metabolism
fgr00650  Butanoate metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
Module
fgr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    FGSG_01572
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    FGSG_01572
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FGSG_01572
   00430 Taurine and hypotaurine metabolism
    FGSG_01572
Enzymes [BR:fgr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     FGSG_01572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 23549005
NCBI-ProteinID: XP_011317385
UniProt: I1RD80
LinkDB All DBs
Position
1
AA seq 568 aa AA seqDB search
MSLAQHSESASPVPIIETDDQGNPIKSSNGYFPSKGKSSTLVDNMAHLSVVGGAHRGDDS
DAASVRSTSSRASRRPEMKLASYQDEYTTSVYGSRFAGMDLPRHHMPENEMPRDIAYRMI
KDDLSLDNNPMLNLASFVTTYMEDEAEKLMAESFSKNFIDYEEYPQSADIQNRCVNMIGD
LFHAPPGSSVGTSTVGSSEAIMLGVLAMKRRWKNRRIAEGKSTEHPNIVMSSAVQVCWEK
ATRYFEIDEKLVYCTPDRFVMDPEQAVDLCDENTIGMCAILGTTYTGEYEDIKAINDLLV
ERNLDVPIHVDAASGGFVAPFVVPDLEWDFRCEKVVSINVSGHKYGLVYPGVGWVIWRSP
EFLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKHGYRAIMSNLTRTADY
LTETLENMGFVIMSERSGAGLPLVAFRFKTVDEGGDPERHYDEFALAHHLRSRGWVVPAY
TMAPNSGVKMLRVVVREDFTKSRCDQLICDVKLCHGLLKETDQESIKKREEYIKNHIVTM
GRGKHSHPVYKDEQHSLQGKHGKTHAIC
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgctcagcattcagaaagtgcgtcgcccgttcccattattgagacagacgac
caaggaaaccccatcaagtcaagtaacggatacttcccttccaaaggaaaatcttcaacc
ctcgttgacaacatggctcacctctctgttgttggtggtgctcaccgcggagacgactct
gacgctgcatccgtccgttctaccagctctcgggcctcacggaggcctgagatgaagctg
gcgagctaccaggatgagtacaccaccagcgtctacggatctcgctttgcgggcatggat
cttcccaggcatcatatgccagagaacgaaatgccccgcgacattgcctatcgcatgatc
aaggacgatctgagtcttgacaacaaccccatgctcaacttggcttctttcgttacaact
tacatggaagatgaagccgagaagctcatggcagagtcattctccaagaactttatcgat
tatgaagagtaccctcaatccgccgacatccagaaccgatgcgttaacatgatcggcgat
cttttccacgctcctcccggttcgtcagtcggtacatcaaccgtcggttcctcagaagcc
atcatgctcggtgttctggccatgaagaggcgctggaagaaccgcagaatcgccgagggt
aagagtacagaacatcccaatatcgtcatgtcctcggccgttcaggtctgttgggaaaag
gccactcgctactttgagattgacgagaagctcgtctactgtacgcctgatcgttttgtc
atggatccagaacaggccgttgacctgtgtgacgagaacaccattggtatgtgtgctatt
cttggaacgacttatactggtgagtacgaggatatcaaggccatcaacgatctcctcgtt
gagcgcaaccttgatgtcccaattcacgtcgatgctgccagtggaggctttgtggctcct
tttgtagttcctgacctagagtgggatttcagatgtgaaaaggtcgtctctatcaacgtc
tcgggtcacaagtacggtcttgtctatcctggtgttggttgggtcatctggcgatctccc
gagttcctcccccaagaactcgtcttcaacatcaactacctcggtgccgatcaatcatct
ttcaccctcaacttctccaagggtgcatcacaagtcattggccaatactaccagctcatc
cgcctcggcaagcacggttaccgcgctatcatgagcaacctcacccgtaccgccgactac
ctgacagaaaccctagagaacatgggcttcgtcatcatgtcagaacgttcgggcgctggt
cttcccctggttgctttccgtttcaagaccgttgacgaaggtggtgatcctgaacgtcac
tacgatgagttcgctctcgctcaccacctgcgttctcgaggttgggttgtccctgcttac
accatggctcccaactctggcgtgaagatgctgagagttgttgtccgagaggactttaca
aagagtcgatgcgaccagctcatctgcgatgtcaagctgtgccacggtcttcttaaggag
acagaccaggagtcaattaagaagcgtgaagagtacatcaagaaccacattgttactatg
ggacgtggaaagcattcccaccccgtatacaaggatgagcaacattctctccagggcaag
catggcaagacacatgctatttgctag

DBGET integrated database retrieval system