KEGG   Fusarium graminearum: FGSG_03061Help
Entry
FGSG_03061        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
Organism
fgr  Fusarium graminearum
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc FAD_binding_3 Pyr_redox_3 F420_oxidored AlaDh_PNT_C Shikimate_DH Pyr_redox
Motif
Other DBs
NCBI-GeneID: 23550396
NCBI-ProteinID: XP_011322720
UniProt: I1RH23
LinkDB All DBs
Position
2
AA seq 387 aa AA seqDB search
MPRLPFPAFKSLVIQPLRITPTAINRSYYSTMMRAARYYGREDIRVEQVPQPSVKAGQVK
VAPAFVGICGTDLHEYLGGPNFCPTTPHPITKESIPVTLGHEFSGIITEVGPDVEGFEVG
QPCAIQPTLFCGHCAACHNHAENVCHSGGFIGLSGSGGGLSESVCVNATHVHPLPQDLPL
EIGALVEPLSVSWHAMTAAPDINPDSRVVILGGGPIGLAMILCLKAKGVDEIIVSEVATS
RQKFARELGATWVVNPIEENLNEIVLALTEGKGADVVFDCAGVPMSIKSACEVVRPKGTV
VNLAIWEKEIPFNPNWITMKESSYKSVLGYTHKDFQAVIANLASGAIKPSQMITRKIKLE
NIVEDGIKALIHDKNNQVKVLVDMSDR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgccaagactgccatttccagcattcaaatccctcgttatacaacccctccgcataaca
cccacagccatcaatcggtcgtattacagcaccatgatgcgagcagcgagatactatggt
agagaagacattcgtgtcgagcaagttcctcagccttccgtcaaggcaggacaagttaag
gttgccccggcgtttgtcggcatctgcggaacagatttgcacgagtatttaggaggcccc
aatttctgtccaacaacacctcatcccatcactaaggaatctattcctgttacccttgga
cacgaattctccggtatcatcaccgaggtcggtcctgatgttgaaggtttcgaagtcggc
cagccctgcgctattcagccaaccctattctgcggccactgtgcagcttgtcacaaccac
gccgagaatgtctgtcacagtggtggcttcataggattgagtggaagtggcggaggatta
agcgaatctgtttgcgtcaatgccacacatgttcatcctcttcctcaagatctgcctcta
gagattggagcgcttgttgagcctctctctgtttcgtggcacgcgatgactgcggcacca
gatattaacccagattctagagttgtgatcctcggaggtggccctattggcttggccatg
attctatgtctcaaagcaaagggcgttgacgaaatcattgtttcagaggtcgcaacctca
cgtcagaaatttgcgagagagcttggtgccacgtgggttgtgaatccgatcgaggagaac
ctcaacgaaattgtgctcgctttgactgagggcaagggtgctgatgttgtgtttgattgt
gctggtgtaccgatgagtatcaaaagcgcatgtgaagtcgtcaggcctaagggtacagta
gtcaatctcgccatctgggagaaggagattcccttcaatcccaactggattacgatgaag
gagagctcatacaagtctgtcttgggatacacccacaaagacttccaggctgtcattgca
aatcttgcttcaggtgctataaagcctagccagatgatcacaagaaagataaaactcgag
aacatcgtggaagatggaataaaggcgttgattcatgataagaataaccaagtaaaggtg
ttggtggatatgagcgacagatga

DBGET integrated database retrieval system