KEGG   Fusarium graminearum: FGSG_03462Help
Entry
FGSG_03462        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
fgr  Fusarium graminearum
Pathway
fgr00052  Galactose metabolism
fgr00500  Starch and sucrose metabolism
fgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FGSG_03462
   00500 Starch and sucrose metabolism
    FGSG_03462
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     FGSG_03462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 23550770
NCBI-ProteinID: XP_011322253
UniProt: I1RI39
LinkDB All DBs
Position
2
AA seq 960 aa AA seqDB search
MFFKKLLTSAAALTGTALAQSKAGVDDLDKPRRDLFEKDLSKCPGYKATKHWETHSGFYA
DLSLAGEACDVFGIDLPKLKLEVEYQTEDRLHVKILDTNNTVYQVPDDIFPRPGFGQWAS
PKNSKLKFDFKADPFSFTVSRRDTDEVLFDTSGSDLVFESQYVYLKTKLPDHPHLYGLGE
HSDPFMLNSTNYTRTIYTRDSYGTPKGQNLYGAHPIYFDHREKGTHGVFLLNSNGMDVFI
DKKKDQQFLEYNIIGGVLDFYFVAGPSPREVAKQYAEIVTLPLMAPYWGLGFHQCRYGYR
DVYEVAAVVANYSAAGIPLETMWTDIDYMDRRRIFTIDPERFPADKYKDLVETIHARDQK
YIVMVDPAVYDMESNPALDSGLEYDTFMKEPNGSDYRGVVWAGPSVFPDWFNPNSQKYWN
DLFINFFDGENGPDIDGLWIDMNEPANFFNRPYPGNNTTPEKFAEIDGDPPKPPPVRDGP
PAPIAGFPDSLQPASSRHNTREVASIAKTTIHKRTVAARTTPRSRGVGQWAAKKHWGQNK
YGRPGSSWQSGKKTGSGCGEDECKGLPNRELIQPPYMIQNGAGPTLADGTTDTDLVQSGD
YLQYDTHNLYGAQMSTHSHNAMRARRPDKRALVITRSTFAGSGKDVSHWLGDNLSIWDQY
RFSIGQLLQFASIYQIPVVGADVCGFGGNVTETLCARWATLGSFYTFFRNHNEITAASQE
FYRWPKVAEAARTGIAIRYKLLDYIYTAIYKQNQTGTPTLNPLFFNYPNDKNTYSIDLQF
FYGDGILVSPVTKENSTELEYYLPDDIFYEWSTGKPVRGTGSYESAEVELTDIMVHYKGG
VIYPQRVESANTTTALRKKGFNLVIAPGLNGKAHGSLYLDDGESVVQDAVSEIDFSYTKG
KLSMSGSFEYDAGVKIETITILGVDKKPKGTDHAEYDSENKKLTFTADVPLTKKCYVDLF
NT seq 2883 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaagaagctgctcacctccgccgcagccctcacaggcactgcgcttgcccag
agcaaagcaggcgtcgatgacctcgacaagccccgcagagaccttttcgaaaaggacctc
tccaagtgccctggctacaaggccacaaagcactgggagacccattctggcttctacgcc
gacctctccctcgcgggtgaggcttgcgatgtctttggaattgatctgcccaagctgaag
cttgaggttgaataccagaccgaggatcgactgcacgtcaagatcttggatacaaacaac
actgtttaccaagttccagatgatatcttccctcgtcctgggtttggacagtgggcttca
cccaaaaactccaagctcaagtttgacttcaaggcggatcctttctccttcactgtgtcc
aggagggacaccgatgaagtgctttttgacacatcgggaagcgacctagtctttgagagc
cagtatgtctatctcaagaccaagctccccgaccatcctcacctctacggtcttggcgag
cacagtgatcctttcatgctgaattcgaccaactacacccgcactatctacacccgcgac
tcatatggtacacccaagggccagaacctctatggagctcaccccatctactttgaccac
cgggagaagggcacccacggtgtcttcctcctcaactccaacggcatggatgtattcatc
gacaagaagaaagaccagcagtttttggagtacaacatcattggtggcgttctcgacttt
tacttcgtcgctggaccttcgcctcgtgaagttgcgaagcagtatgctgagattgttact
ctgcctctcatggcgccttactggggtctcggtttccaccagtgcagatacggttatcgc
gatgtttacgaagttgctgctgttgtagccaactattccgctgctggaatcccactcgag
actatgtggacagatattgactacatggaccgtcgacgtatcttcaccatcgacccggaa
cgcttccctgcagacaagtacaaggacctcgttgaaacaattcatgcacgagaccagaag
tacatcgtcatggttgaccccgccgtgtatgacatggaatccaatcccgcccttgactca
ggtctcgagtatgacactttcatgaaagagcccaacggctcagactaccgaggtgttgtc
tgggccggacccagtgtcttccctgactggttcaaccccaactcgcaaaagtactggaac
gatctctttatcaacttcttcgatggtgaaaacggtcctgatatcgatggtctctggatt
gatatgaatgagcctgccaactttttcaaccgtccttatcctggaaacaacaccactcct
gagaaattcgcagagatcgatggtgatcctcccaagcctcctcctgttcgtgatggccct
cctgctcctattgctggcttccccgatagtctgcagcccgcatcttcccgtcacaacaca
cgtgaggttgcttccatcgccaagactaccatccacaagcgcaccgtggcagctcgcaca
acaccccgcagccgtggcgtaggacagtgggcagccaagaagcactggggccagaacaag
tacggtcgtcccggctccagctggcaaagcggcaagaagacaggatctggttgtggcgag
gatgagtgcaagggtcttcccaaccgagagctcatccagcctccctacatgatccagaac
ggcgctggacctacgctcgctgacggcactaccgatactgatcttgtgcagagtggagat
tatctccagtatgatacacacaacttgtacggcgctcagatgtcaacgcactcgcataac
gctatgcgtgctcgacgtcccgataagcgtgctcttgttatcacgcgtagtacctttgct
ggctctggcaaggatgtttctcactggcttggagacaacctctctatctgggatcagtac
cgcttcagcatcggccagcttctccagttcgcatccatctaccagattccagtcgttggt
gccgacgtctgtggcttcggcggcaacgtcaccgagactctttgcgctagatgggctacg
cttggaagtttctacactttcttccgtaaccacaatgagatcactgctgcatcccaggag
ttctaccgttggcccaaggtcgccgaggcagcccgcactggtatcgccattcgctacaag
ctcctcgattacatttacactgccatttacaagcagaaccagacaggcacccctactctc
aaccccctgttcttcaactaccccaacgacaagaacacatactccatcgatcttcagttc
ttttatggtgatggcatccttgtcagccctgttacaaaggaaaacagcactgagttggag
tactatctccccgatgacatcttctacgagtggtctaccggaaagcctgtccgtggcact
ggttcatacgagtctgctgaggttgagctcaccgatatcatggtccactacaagggtggt
gtaatctaccctcagcgtgtcgaaagtgccaacactaccaccgctcttcgcaagaagggg
ttcaacctggtcattgcacccggtttgaacggcaaggcgcatggatctctgtacctcgac
gatggcgagtctgttgttcaagacgctgtgtccgagattgacttctcttacaccaagggc
aagctgagcatgagtggaagctttgagtacgatgccggtgtcaagattgagacgatcacc
attcttggtgtcgacaagaagcccaagggaaccgatcatgcagagtacgactctgagaac
aagaagctgacctttacggcggatgttcctttgacgaagaagtgttatgtagatctcttt
tga

DBGET integrated database retrieval system