KEGG   Fusarium graminearum: FGSG_04152Help
Entry
FGSG_04152        CDS       T01038                                 

Definition
(RefSeq) repressible alkaline phosphatase precursor
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr00730  Thiamine metabolism
fgr00790  Folate biosynthesis
fgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    FGSG_04152
   00790 Folate biosynthesis
    FGSG_04152
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     FGSG_04152
Exosome [BR:fgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FGSG_04152
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fgr00537]
 Enzymes
  FGSG_04152
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 23551415
NCBI-ProteinID: XP_011321478
LinkDB All DBs
Position
2
AA seq 559 aa AA seqDB search
MANESDPLLSGSGHDRSDTQAESKAHRNSRLRELGLFAWALIATAAVIVVAIWTQHEQQT
KHDHNTPATKRNLVFMVSDGMGPATLSLTRSYRQHVEDLHFGDTLTLDKHFWGTSRTRSN
SSLVTDSAAGATAFSCGKKTYNGAISTLPNHDPCGTVLEAAKRAGYHTGLVVTTKIEDAT
PACFNSHVVLREMEDEIALQQIGEGVLGRTVDLMLGGGRCNYLPSSAEGSCRADDTDVVK
IAKEKHNWTYADDRAGFDALKGGNNVKLPFLGLFASSDIPFEIDRRNHNDVYPSLSEMAK
TALRALEKATEKSDKGFFIMIEGSRIDHAGHINDPAAQVHEVLEYDKTFRAVLDFIKESK
TETVLVATSDHETGGLATALQEPGHLPVYNWYPKVLANATASAEWLHAKLNAHIASNSEA
KKNKEKLKEYINEELIIRGLGISNASDKEITTIAEHPESALVLFSALISLRAHIGWSTHG
HTAVDVNIYSSGGPRTENIRGNVENTDVGKYLREYLEVDVDAITEELQDKMSKIKVQDAG
MEALDEVWPLGNKHHAIQG
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgaaagcgatcctctcttgtccgggtccggtcacgaccgctccgatacccag
gccgaaagcaaggcccatcgaaactcgcgtctccgtgagctcggcttgtttgcctgggct
ttgatcgctacagccgctgttattgtcgtcgctatctggacccaacatgagcagcagaca
aagcatgaccacaacacacctgccacgaagcgaaatctcgtcttcatggtgtcagatggc
atgggccccgctacattgtccttgactcgcagctaccgacagcacgttgaagatctccat
tttggcgataccctcaccctcgacaagcatttttggggcacgagcaggactcgctccaat
agctcccttgtcaccgacagcgctgccggtgccactgccttctcctgcggaaagaagacc
tacaacggtgccatttctactctgccaaaccacgatccttgcggaacggtcttggaagct
gcaaagcgcgctggataccacactggtctcgttgtgactacgaagattgaggatgcgact
ccagcctgcttcaactcgcacgttgtgctccgtgaaatggaagatgagattgctcttcag
cagatcggagagggtgtactcggacgaaccgtcgacctgatgcttggtggtggtcgatgc
aactacctgcctagcagcgcggagggcagctgccgagctgacgataccgacgtggtcaag
attgcaaaggagaagcacaactggacctacgctgatgaccgggctggttttgatgctctc
aagggcggcaacaatgtgaagctgcctttcctcggactgtttgcgtcaagcgacatcccc
ttcgagattgaccgccgaaaccacaacgatgtctacccttcgctgagcgaaatggccaag
actgctcttcgtgctcttgagaaggctactgagaagagcgacaagggcttcttcatcatg
attgagggcagccgaatcgaccatgctggtcacatcaatgatcccgccgctcaggtccac
gaggttcttgagtacgacaagaccttccgagctgtcctcgacttcatcaaggagagcaag
accgagactgttctcgttgcaaccagtgatcacgaaacaggtggccttgctaccgcgctt
caggaacctggccacctccctgtttacaactggtaccccaaggtccttgccaacgcgact
gcctcagctgagtggctccacgcgaagctcaacgcccatatcgcctcgaactctgaggcc
aagaagaacaaggaaaagctcaaggagtacattaacgaggaactcattatccgtggtctc
ggtatctccaacgcctcagacaaagagatcaccaccattgcagagcaccctgagagcgcc
cttgtcctcttctcggctctcatttctctgcgtgcacacatcgggtggagcactcacggc
cataccgcagttgatgtcaacatctacagctctggtggaccccgaacagagaacatccgc
ggtaacgtggagaacactgacgtgggcaagtatctgcgcgagtacctcgaggttgacgtc
gacgccatcaccgaggaattgcaggacaagatgagcaagatcaaggttcaggatgcaggt
atggaagccctcgatgaggtatggcctcttggaaacaagcaccacgctatccagggttaa

DBGET integrated database retrieval system