KEGG   Fusarium graminearum: FGSG_04154Help
Entry
FGSG_04154        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    FGSG_04154
Enzymes [BR:fgr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FGSG_04154
DNA repair and recombination proteins [BR:fgr03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     FGSG_04154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_M BRCT_2 RNA_ligase DNA_ligase_A_C BRCT LIG3_BRCT DNA_ligase_IV PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 23551417
NCBI-ProteinID: XP_011321476
LinkDB All DBs
Position
2
AA seq 941 aa AA seqDB search
MSQNDDAQHEDDIQYASMGVTREELEEKYPNRPKNHSKTLVFSELFREVFNPLNENKKQN
AAGSGPKKSFRGVNKLSPHEQRRHIIDRFITRWRKEVGPDFYPALRLILPDKDRDRGVYG
LKENAIGKLLVKLMKIDKNSEDGYSLLHWKLPGQTMASRLAGDFAGRCFEVISKRPMRTQ
VGNMTIAEVNEQLDKLASSSGEMENLLLKQMKVGATEKTFLDLWHPDGDALFSVSSSLKR
VCWELWNPEIRLEQDETGVALMQCFQPQLAQFQMPASFQKMIQLLRPTEEDPEFWIEEKL
DGERMQVHMVQDKSHPGGRKFCFWSRKAKDYTYLYGDGLQDETSSLTRHLKDAFASGVKN
LILDGEMITWDMGVDKIVPFGTLKTAAISEQQNKSASDTVHPTGPTSSSRKGNKTRLSST
RNHEYTSATSADAIEPLLREVVANASEGLVLKNPRSMYRLNSRNDDWLKVKPEYMSEFGE
SLDCVIIAGYYGTGKRGGALSSFLCGLRVTQNHIQAGANPEKCFSFFKVGGGFRAEDYAE
IRHRTEGKWIEWDQRNPPSEYIELGGGEARQFERPDVWIRPKDSVVVSVKAASVGPSDSF
ALGFTLRFPRFRRLRLDRSWNTALSLEEFQELKQRVDEESKEKAMTVEDRKRHNPKRVKR
ELTIAGEDTKVAEFMGETTKLFEGLEFCVLSEALKPYKKTKTQLETIIKENGGVISQRAA
PGTNMVLIADKKVVKVASLVKGGDVNIIRPKWIRDCLEQELGAFLLPFEDTHLFHATDAL
KRAASENTDQFGDSYTRDLSIEELRQVMNDMPKIEDGISFDKNEFLQQLEERGKDLGPLK
SLTFRRCVMLFHAVEAGDKRISRLENLVRYGGGSVTGDANDLSVTHVVIQGDDPMQVGEA
ADMIRKELSSRSIQPRVVTGAWIDECWKESTLLDEEQFVVP
NT seq 2826 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaaacgacgacgcacagcatgaagatgatatccaatatgcttccatgggagta
actcgtgaagagctggaagaaaagtatccaaaccgcccaaagaatcactcaaagacactc
gttttctctgagctgttccgagaagtcttcaacccgctcaatgaaaacaagaagcagaac
gccgcgggctcggggcctaaaaaatcgtttcgtggagtgaacaagctctccccccacgaa
caacgtcggcacatcattgaccgtttcattacccgatggcgcaaggaagttggtcctgat
ttctatcctgcgttgcgcttgattctcccagataaggatcgcgaccgtggagtttacggc
ctcaaagaaaacgcaattggaaaactactcgtcaagctcatgaagatcgacaaaaactct
gaagatggctacagtcttttgcactggaagttgcctggccagactatggcatctcgactg
gccggtgactttgctgggcgttgcttcgaggtcatctcaaagaggccaatgcgaacacag
gtcggcaacatgacaattgccgaggtgaacgagcagctggataagcttgcgtcttccagc
ggagaaatggaaaatctgctcctcaagcagatgaaagtcggtgccacggagaagactttc
ttagatctttggcatccagatggtgacgccttattcagcgtatcatcaagcttgaagcgt
gtgtgctgggaactctggaatccagaaattcgtcttgaacaggacgagacaggcgtcgct
ctaatgcaatgtttccaacctcagctggctcaatttcagatgcctgcgtctttccaaaag
atgattcaactccttcgaccgaccgaagaagatcccgagttttggatcgaagagaagctg
gacggtgagcgtatgcaagtgcacatggtccaggataagagtcacccgggtggcaggaag
ttttgtttctggtcacgaaaggctaaagattacacatatctttacggtgacggtctccaa
gacgaaacgtcgagtcttactagacatctcaaggatgccttcgcatccggcgtgaaaaac
ttgatcttggacggcgagatgatcacttgggacatgggtgtcgacaagatagtacctttc
ggcaccctaaaaacagcagcaatttccgagcagcaaaacaagtcggcctctgacacagta
caccctacgggaccgacatcgagctctagaaaaggcaataaaacccgtttatcgtcgact
cgaaatcacgaatacaccagcgcaacgagtgccgatgccattgagcctcttcttcgcgaa
gtggttgctaacgcttccgaaggccttgttttgaagaacccacggtccatgtaccgcctc
aacagccgaaacgacgactggctcaaagtgaaacctgaatacatgtccgagtttggagag
tcccttgactgtgtcattattgctggctactatggtacaggaaaacggggtggcgctcta
tcaagtttcctgtgtgggctgcgtgtcacgcaaaaccatatacaagctggtgcgaatcct
gaaaagtgcttcagtttcttcaaagttggtggtggttttcgcgcagaggactatgcggaa
atccgacatagaacggaaggcaaatggatcgaatgggatcaacgaaacccaccgtcagag
tatattgagctgggaggaggtgaggctagacaatttgagcgcccggatgtttggattcgg
cccaaagattccgttgtggtctcggtcaaagccgccagtgttgggccttccgattcgttc
gctctgggtttcactttgcgatttccacggttcaggcgtctgcgattagaccggagctgg
aatactgctctctcactcgaggaattccaagagttgaaacaacgtgtcgacgaagaatca
aaggagaaggcgatgacggttgaagacaggaagcgccacaaccctaaacgagtcaagagg
gaactcaccattgctggagaagataccaaggtggccgagtttatgggagagacgacaaaa
ctgttcgaaggcctggaattttgtgttctttccgaagcactcaagccctacaaaaagacc
aaaactcagcttgagaccatcatcaaggagaatggcggcgtcatctcgcaacgagcagca
cctggcacgaacatggttcttatcgccgataagaaggtcgtcaaagtggcaagtcttgtg
aaaggaggggacgtgaacatcatccgccccaaatggattagagattgcctcgagcaggaa
ttgggcgcgtttcttttgccatttgaggatacacatctattccacgcaactgatgcgttg
aaaagggcggcgagcgaaaacacagatcagtttggtgacagctacacacgcgatctatct
atcgaagagcttaggcaagtcatgaatgacatgccaaagattgaggacggcatatccttt
gacaagaatgaattccttcaacagcttgaggaacgtggaaaagacctggggcccttgaag
agcctcacctttcggcgttgcgtgatgctatttcacgccgtggaagctggcgataaaagg
atttcgaggctagagaatctcgtcaggtatggcggaggaagtgtcacaggtgacgcaaac
gacttatccgtgactcatgtggtgatacaaggcgacgacccgatgcaggttggcgaggca
gctgatatgattcgcaaggaactaagctctaggtctatacagccgcgagtggtgacaggg
gcttggatcgacgaatgctggaaagagagcacgctacttgacgaagagcaattcgtggtc
ccttaa

DBGET integrated database retrieval system