KEGG   Fusarium graminearum: FGSG_04212Help
Entry
FGSG_04212        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fgr  Fusarium graminearum
Pathway
fgr00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FGSG_04212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fgr02000]
    FGSG_04212
Enzymes [BR:fgr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FGSG_04212
Transporters [BR:fgr02000]
 Other Transporters
  Pores ion channels [TC:1]
   FGSG_04212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 23551472
NCBI-ProteinID: XP_011321414
UniProt: I1RK24
LinkDB All DBs
Position
2
AA seq 291 aa AA seqDB search
MQFTNYSRPTAMTNVDTSLPPEPTGAAANFAAQHSEEHPLKLYGGWFCPFVQRSWITIHE
KRIPHQYVEINPYKKEPHFLALNPRGLVPTLAVPFDVQGKEQKALFESNIVCEYLDEAFF
DESKHGPRLLPTEPYEKARCRIWIDHISTRIIPAWYKLMQHTPDKAFSLEDAREELKGHI
KSFVEEMDSEGPWFLGSTLSLVDICFAPWAKRLFLIDYYKEGGHGIPTTGEGEDGDVWNR
WNKWYKAILKRDSVNETWSADERYIIAYKRYAEDTTNSEVGQATRSGKRLP
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgcagttcacaaactactctaggcctactgccatgaccaacgtcgatacttcactgccc
ccagagcccactggcgctgccgccaactttgctgctcagcattcagaggagcacccgctg
aagctttacggcggctggttctgtccttttgttcagcggagttggatcactatccatgag
aagagaatccctcatcaatatgtcgagatcaacccttacaaaaaagaacctcacttcttg
gcactgaaccctcgcgggctggtgcccacacttgcggtcccctttgacgtacaaggcaaa
gagcagaaagctttgttcgagagcaacattgtctgtgagtatctggatgaagcattcttt
gatgagtctaagcatggtcctcgtctgcttcctacagaaccatatgagaaggctcgatgt
cgtatctggatcgatcatatcagcacacgcattatccctgcctggtacaagctcatgcag
cacactcccgacaaagcgttcagcctcgaagatgcaagagaagagctcaaaggtcacatc
aaatcctttgtggaagagatggactctgaaggtccatggtttcttggctcaactctgagt
ctcgtggatatttgctttgcgccttgggcaaaacgcttatttctgattgattattacaag
gaaggtggacacggtattcctacaactggcgagggcgaagacggcgatgtttggaatagg
tggaacaagtggtataaggcgattcttaaacgtgacagtgtgaacgagacgtggagtgct
gatgagcgatacataatcgcttataagagatatgccgaggatactaccaactccgaggtt
ggtcaggctacacgatcaggcaaacggcttccttag

DBGET integrated database retrieval system