KEGG   Fusarium graminearum: FGSG_04309Help
Entry
FGSG_04309        CDS       T01038                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
fgr  Fusarium graminearum
Pathway
fgr00020  Citrate cycle (TCA cycle)
fgr00310  Lysine degradation
fgr00380  Tryptophan metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
fgr01130  Biosynthesis of antibiotics
fgr01200  Carbon metabolism
Module
fgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FGSG_04309
  09105 Amino acid metabolism
   00310 Lysine degradation
    FGSG_04309
   00380 Tryptophan metabolism
    FGSG_04309
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     FGSG_04309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 23551567
NCBI-ProteinID: XP_011321306
UniProt: I1RKB2
LinkDB All DBs
Position
2
AA seq 1051 aa AA seqDB search
MLRNSLCRASSQLLRGARCSAASSTASISTLSARTSSWKLAASRRPLAVGARRTYATSAT
SSPPDPNDNFLSGSTASYIDEMYMQWRQDPESVHVSWQVYFKNMEGGEMPISQAFQPPPN
LVPGMTGGVPRLSGNLAMEDGSDVTNHLKVQLLVRAYQSRGHHTAKIDPLGIRGTNDAKG
FANIKPKELTLEHYGFTEKDMDTEYTLGPGILPRFKRDGREKMTLREIVDACERIYCGSF
GVEFIHIPDRDKCDWLRERLEVPNPFKYSVDEKRRVLDRLIWSSSFESFLATKYPNDKRF
GLEGCETLVPGMKALIDRSVDYGVKDIVIGMPHRGRLNVLSNVVRKPNESIFSEFAGTSG
GEDEGSGDVKYHLGMNFERPTPSGKRVQLSLVANPSHLEAEDPVVLGKTRAIQHYNNDEK
THRTAMSVLLHGDAAFAAQGIVYECLGFHSLPAFSTGGTIHLVVNNQIGFTTDPRFARST
AYCTDIAKAIDAPVFHVNADDVEAVNFVCQLAADWRAEFQHDVVIDLNCYRKYGHNETDQ
PSFTQPLMYKRINAKEPQIDIYVNKLIEEGSFSKADVEEHKQWVWGMLEESFTKSKDYTP
TSKEWTTSAWNGFKSPKELATEVLATNETNVKSTTLEHIGNAIGSVPEGFQVHRNLKRIL
SNRTKSVVEGKNIDFPTAEALAFGTLVTEGYHVRVSGQDVERGTFSQRHAVFHDQETEDT
HTPLQNLSQDQGKFVISNSSLSEFGALGFEYGYSLSSPHALVMWEAQFGDFANNAQCIID
QFIASGEVKWMQRTGLVMSLPHGYDGQGPEHSSGRLERYLQLSNEDPREFPTGEKLVRQH
QDCNMQIAYFTSPANLFHALRRQMHRQYRKPLIIFFSKSLLRHPLARSDIEAFTGENAGF
QWIIPDPEHETGAIKSPDQIERVVLCTGQVWAALHKYRADNNIDNVAFTRIEQLNPFPWQ
QLKENLDQYPNAKTIVWCQEEPLNAGAWSFTQPRIETLLNNTEHHTRKHVMYAGRNPSAS
VATGLKNVHTKEEKDFLEMAFTVKQDKLKGE
NT seq 3156 nt NT seq  +upstreamnt  +downstreamnt
atgttgaggaattcgctttgtagagctagctcgcagctccttcgcggtgctcgatgctct
gctgcctcttctaccgcctccatctcgaccctctcggcccgcacctcatcatggaagctc
gctgcctcccgtcgtcctctggctgtcggtgctcgtcgcacctatgcgaccagcgcgacc
tcgtcaccccccgaccccaacgataacttcctttccggaagcaccgccagctacatcgat
gagatgtacatgcagtggagacaagatcccgagagcgtccacgtctcttggcaggtctac
ttcaagaacatggagggcggcgagatgcccatctctcaggctttccagcctcctcctaac
ctggttcctggcatgactggcggcgtccctcgtctttctggcaacttggccatggaggac
ggttccgatgtcaccaaccatctcaaggtccagcttctcgtccgcgcttaccagtctcgc
ggccaccacaccgccaagattgaccctctcggtatccgaggcaccaatgacgccaagggt
ttcgccaacatcaagcctaaggaattgactctcgagcactacggattcactgagaaggat
atggacaccgagtacactctcggccccggtatcttgcctcgcttcaagcgtgatggccgt
gagaagatgactctccgcgagatcgttgacgcttgcgagagaatctactgcggttctttc
ggtgttgagttcattcacattcctgaccgtgacaagtgcgactggctccgtgagcgtctc
gaggtccccaaccctttcaagtactctgttgatgagaagcgccgtgtcctcgaccgtctt
atctggagttccagctttgagtctttcctagccaccaagtaccccaacgataagcgattc
ggtctcgagggttgcgaaacccttgttcctggtatgaaggctcttattgaccgcagtgtt
gactacggtgtcaaggatatcgttatcggtatgccccatcgtggtcgtctcaacgtcctc
tccaacgtcgtccgaaagcccaacgagtcaatcttcagcgagtttgctggtacatctggt
ggtgaggatgagggctctggtgacgtcaagtaccatcttggtatgaactttgagcgcccc
acgccttctggcaagcgcgtgcagctttctctggtcgccaacccttcgcatctcgaggcc
gaggaccccgtcgtcctgggcaagacccgtgctatccagcactacaacaacgatgagaag
acccaccgtactgccatgagtgttctcctccacggtgatgctgcctttgctgctcagggt
atcgtctacgagtgtctcggcttccactctctccctgccttctccactggaggcaccatc
cacctggttgtcaacaaccagattggtttcacaaccgacccccgtttcgcccgatccacc
gcctactgtaccgatattgccaaggctatcgacgcccccgtcttccacgttaacgccgac
gatgtcgaggccgtcaactttgtctgccagctcgctgccgattggcgcgccgagttccag
cacgatgttgtcatcgatctcaactgttaccgaaagtacggtcacaacgagacggatcag
ccttctttcacacagcctctcatgtacaagcgcatcaacgccaaggagcctcaaattgac
atctacgtcaacaagcttatcgaggagggttctttctccaaggccgatgtcgaggagcac
aagcagtgggtctggggtatgctcgaggagagcttcaccaagtccaaggattacacacct
acctccaaggagtggaccacctccgcctggaacggcttcaagtcccctaaggagctggct
actgaggttcttgccaccaacgagaccaacgtcaagagcactaccctcgagcacattggt
aacgccattgggagcgttcccgagggcttccaagttcaccgcaacctgaagcgtatccta
agcaacagaaccaagtctgttgttgagggtaagaacatcgacttccctaccgctgaggcc
ctggctttcggtactctcgtaactgagggttaccacgtccgtgtctccggtcaggatgtt
gagcgtggtactttctctcagcgtcacgctgtcttccacgaccaggagactgaggatacc
cacactcccctccagaacctgagccaggaccagggcaagtttgtcatctccaactcttct
ctgagtgagttcggtgcccttggtttcgagtacggttactctctgtcatctcctcatgct
cttgtcatgtgggaggctcaattcggtgactttgccaacaacgctcaatgtatcatcgac
cagttcatcgcctctggtgaagttaagtggatgcagcgaacaggtcttgtcatgtctctg
ccccacggttacgatggtcagggccctgagcactcctctggacgtctcgagcgatacctc
cagctcagcaacgaggaccctcgagagttccccactggcgagaagctcgtccgtcaacac
caggactgcaacatgcagatcgcctacttcacctctcccgccaacctgttccacgctctc
cgccgacagatgcaccgccagtaccgcaagccccttatcatcttcttctccaagtctctc
ctccgtcaccctcttgctcgcagcgacattgaggctttcactggcgagaacgccggattc
cagtggatcatccctgaccctgagcatgagactggtgctatcaagtctcctgaccagatt
gagcgtgttgttctgtgcaccggtcaagtttgggctgccctccacaagtaccgagctgac
aacaacatcgacaacgtcgctttcactcgcattgagcagctgaaccccttcccttggcaa
caactcaaggagaacctcgaccagtaccccaacgccaagaccatcgtctggtgccaggag
gagcctctcaacgccggtgcctggagcttcactcagccccgtatcgagactctgctcaac
aacaccgagcaccacacccgcaagcacgtcatgtacgctggccgaaaccccagtgcctct
gtcgccactggtctcaagaacgtccacaccaaggaggagaaggacttcctcgagatggct
ttcactgtcaagcaggacaagctcaaaggcgagtaa

DBGET integrated database retrieval system