KEGG   Fusarium graminearum: FGSG_05610Help
Entry
FGSG_05610        CDS       T01038                                 

Definition
(RefSeq) succinate dehydrogenase iron-sulfur protein
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr00020  Citrate cycle (TCA cycle)
fgr00190  Oxidative phosphorylation
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
fgr01130  Biosynthesis of antibiotics
fgr01200  Carbon metabolism
Module
fgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fgr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fgr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FGSG_05610
  Energy metabolism
   00190 Oxidative phosphorylation
    FGSG_05610
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FGSG_05610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 23552787
NCBI-ProteinID: XP_011324170
UniProt: I1RNM7
LinkDB All DBs
Position
3
AA seq 278 aa AA seqDB search
MAALRSSSRLVGAFSRTAAIRPGTVFTRSMASVSEPAKEPESKLKSFQIYRWNPDTPSEK
PRLQTYTLDLNKTGPMILDALIRIKNELDPTLTFRRSCREGICGSCAMNINGQNTLACLC
RIPTEAASDVKIYPLPHTYVVKDLVPDLTHFYKQYKSIKPYLQRDTPAEDGREYRQTKED
RRKLDGLYECILCACCSTSCPSYWWNSEEYLGPAILLQSYRWLADSRDQRTAERKQNLEN
SMSLYRCHTILNCTRACPKGLNPGKAIAEIKKQMAFGN
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atggctgctctccgatcttcctctcgccttgttggcgccttctcaaggactgctgctatt
cgccccggcactgtcttcactcgctctatggcctcggtcagcgaacctgccaaggagccc
gagtccaagttgaagtccttccagatctaccgatggaaccccgatacccccagcgagaag
ccccgtcttcagacctacactctggacctcaacaagactggacctatgattctcgatgct
cttatccgaatcaagaacgagctcgaccctactctgaccttccgacgaagttgccgtgag
ggtatctgcggtagctgtgccatgaacatcaacggccagaacacccttgcctgcttgtgc
cgtatccctaccgaggctgcttccgacgtcaagatctaccctcttcctcacacctacgtc
gtcaaggaccttgtccctgatctgacacacttctacaaacagtacaagagcatcaagcct
tacctccagcgcgacaccccggccgaagacggacgtgaataccgacagaccaaggaggac
cgacgcaagctcgacggtctttatgagtgcattctctgcgcctgctgctctacttcatgc
ccatcttactggtggaactctgaggagtacctcggtcctgctatcctgctccagtcttac
cgatggctcgccgattctcgtgaccagcgcaccgccgagcgaaagcagaacctcgagaac
tcaatgagtctgtaccgttgccacactatccttaactgtacccgagcctgccccaagggt
ctcaaccctggtaaggcgattgccgagatcaagaagcagatggctttcggtaactag

DBGET integrated database retrieval system