KEGG   Fusarium graminearum: FGSG_05636Help
Entry
FGSG_05636        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K11484  histone deacetylase HOS3 [EC:3.5.1.98]
Organism
fgr  Fusarium graminearum
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fgr03036]
    FGSG_05636
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     FGSG_05636
Chromosome and associated proteins [BR:fgr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     FGSG_05636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl RTP801_C
Motif
Other DBs
NCBI-GeneID: 23552812
NCBI-ProteinID: XP_011324200
UniProt: I1RNQ2
LinkDB All DBs
Position
3
AA seq 1144 aa AA seqDB search
MASSSRPPLSLRRHSSIRHLRQPEHDDLAQSLNQLNISTSPGRAPSRLASEPASPFRPSG
RRTSQSPAPNARAPSRSPSQDPSLGTPTLLRKASMNSLRSSNGIGPGSTSRRSSVAHVMS
PTRRASYQEKIRPTSRSIAHDNLKAELHAHHGSITTRPTQTIVVLNDAVYGHRFSRPRTS
RAALGTIVERPERIRAAVLGVSAAYVRLGGRHCEGEYPLHPGREAEHLQGIPFRIHKTDR
TLSLLSPAVVNVHGARWMEELKTMCEAAESKLALGGKELQRPEMNRGTDKSPENFHEGDL
YLCSESLNAMEGALGAVCEAVDTVFGPGPRRAFVGVRPPGHHCSASHPSGFCWVNNVHVG
IMHAALEHGLTHAAIIDFDLHHGDGSQAITWQHNTRANNAAKNAAAWKKSSIGYFSLHDI
NSYPCEMGDEEKVRSASICIDNAHGQTVWNVHLEPWKSEEDFWKLYETRYTVLLEKVRNY
FKNQAERLRESKEPPKAAIFLSAGFDASEWEGEGMQRHKVNVPTEFYARIAQDVVKLAAE
EGLHVDGRVISVLEGGYSDRALCSGIMSHLSGLAGDQTSEQSSDSAGSFGVDMAQTSPST
VPHGFEQKSALDSIHAYDPSWWSTSNMEELEILMGDPNAAASKYPQYVTLPSYFAPTQAS
TAKSSDPTKMQRSLSKLGSATPRFPSPPPPEVPWAVATHELSKLLIPSTRETGSCKPEDL
NAEASRVRRDRQSILMGIDPRPPPKASTSRPTSRMSLRERRAKPAPPSEPTIDKPPKGRR
STMGPTTVASEKLTSLKAVARGVPSQTNSDEPGVRRSSRRLSEIPVSLTSRLSSPEAVLP
EADEYAHTVPNSPAATTATTAAPNGDLQVKKTRNPAVPRKEPAPKVPRPTKKATTATGPS
RPASAAQKAKSPERAPKNGTAGDDVDNITSGMRKIRINLITQSQKAAKARALLEAEKANG
SVSAIDQAKPVETPSTAAHPSKAQSDDPNTVIVSTEAYNHSPAQSLSINPTPPTTASSSG
IATPLQGQGPFKPSGYVSRLASPPLSSPPIPSVSVHPSAEAGDVFIPYQPEGPTPKPITQ
NEPLKWLPPNVPTSSTQTPATTPSPIKKNKLFQYASSSGIPFAPRTGHQAKGAATTKPAG
PEMK
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttcatcccgcccaccactgtcgcttcggcggcattcctccatccggcatctt
agacagcccgaacatgacgacttggctcagtcgttgaatcaactcaacatctccacttcg
cccggccgagctccgtcccgccttgcctccgaacctgcctctcccttccgtccatcgggc
cgccgtacttcacagtcaccagcaccaaatgcccgagcaccttcacggagcccctcccag
gacccctctttgggcacgcctaccctcctgcggaaagcctccatgaactcattgcgctct
tctaatggaatcgggcctggttcaacttcgagacgttctagcgtggcacatgtcatgtca
ccgacacgcagggcgtcatatcaagaaaagattcggccgacatctcgttccattgctcat
gacaacttgaaagccgaattacatgcacatcatggctctatcaccacccgtccgacccaa
acgattgtggtgctaaacgacgctgtctacggccaccgtttctcccgaccccgaacttct
cgtgccgccctcggtactattgttgaacggcctgagcggataagagctgcagtgttgggt
gtgtccgcagcctatgtgcgcttgggcggtaggcattgtgaaggtgaatacccactccac
ccgggaagggaggcagagcatctccaagggatccctttccggatacacaagacggatcgc
actctttctcttctttcaccagccgtagtcaatgtgcatggagcgagatggatggaagag
ttgaagacaatgtgtgaggcggccgaatcgaagcttgcattgggtggaaaggaactccaa
agacccgagatgaatcgggggactgacaagtctcccgagaactttcatgaaggggacttg
tacctctgctcggaatctctcaatgctatggaaggcgccctcggggctgtttgtgaagcc
gtcgacacagtatttggtccgggcccgcgccgtgctttcgtaggcgttcgacccccgggt
catcactgttctgcttctcatccttctggtttctgttgggtcaataatgtccatgttggt
atcatgcacgcagctctcgagcacgggctcacgcatgctgctatcatcgactttgacctt
caccatggcgatggatctcaggctattacatggcagcataatactcgagcgaacaacgct
gccaagaatgcagcagcgtggaaaaagtcgtcaatcggctacttcagcttacacgacatc
aactcgtacccgtgtgaaatgggcgatgaagaaaaggttaggagcgccagtatctgtatc
gacaacgcacacggccaaacggtttggaacgtccacctcgaaccatggaagtcagaagag
gatttttggaaactctacgaaacgagatataccgtcctcttggaaaaggttagaaactac
ttcaaaaatcaggcagagcgattgagggaatctaaagagccacccaaggctgcaattttc
ctgtctgctgggtttgatgccagcgagtgggagggtgaaggcatgcaacgccacaaggtc
aatgttccgaccgaattttatgcgcgtattgcccaagacgttgtcaagctcgcagctgaa
gaaggcctccacgttgacggccgcgttatcagtgtattggaaggtggctacagtgaccga
gctttatgttctggcattatgagccacctcagtggactggctggtgatcagacaagcgag
caatcatcagacagcgccggctcttttggagtcgacatggctcagacgtcaccaagcacg
gtaccgcatggctttgagcaaaaatcagcattggactccatccatgcttacgacccgtca
tggtggtcgacttcaaacatggaggagctcgagattctaatgggcgaccccaatgctgcc
gcttccaaatacccgcaatatgtcacccttccatcctactttgctccgacacaggcgtca
acggctaagtcctcagatcctacgaagatgcagcgtagcttgtccaagttaggctcggcc
acgcccaggtttccatcgccaccaccaccagaagtcccctgggcggttgcaactcacgaa
ttaagcaaactccttatcccctccacacgcgaaactggtagttgcaagcctgaggatctg
aacgcagaagcaagcagggtcagacgtgaccggcaatcaatattgatgggaatcgaccct
cgccctccgcccaaggcttctacttcacgtccaacatcgcgaatgtctctgcgcgagaga
cgagccaagccagcaccaccctctgagccaaccatcgacaagccacctaaaggtcgcaga
agcacgatgggccccactactgtcgcttcagaaaagctaacttccttgaaggcggttgcc
cgtggcgttccctcacaaacaaacagtgatgaaccaggagtgaggaggtccagccggcgt
cttagcgagatcccggtgtctctcacttcacggctatcttctcctgaggcagtcctgccc
gaagctgatgaatatgctcatacggtgcccaactctcccgcggctacaacggccacaacg
gcagctccaaacggcgacttgcaagtcaagaaaactcggaatcccgctgttcctcgcaaa
gagcctgcacccaaagtaccccggcctaccaagaaagccacaacggcaaccggtccttca
cgtccagcttctgccgcccaaaaagccaagtcaccagagcgagctccaaagaatggcaca
gcgggcgatgatgttgacaacatcacttctgggatgaggaagattcgtatcaacttgatc
actcagtcccaaaaggctgccaaagcacgtgctctccttgaagctgagaaagccaacggc
agtgtctctgctatcgaccaggctaagcctgtcgaaacgccatctaccgctgcgcatcca
tcaaaagcccagtccgatgacccgaacacggttattgtgtctactgaggcttacaaccac
tctcctgcgcagtcgttgtcaatcaaccctacaccacccaccactgcttcgtccagtggc
attgccactcctttgcagggtcagggtccattcaagccttctgggtatgtttctcggctg
gcctctcctccgctgagttcgccacccattccctcggtttctgtccatcccagcgcagaa
gcaggcgatgtctttattccctatcagcccgaaggtcctacacccaagcccatcactcag
aacgagccattgaaatggctccctcctaatgtgccgacttcttctacacaaacacctgcc
acgacacccagtccaatcaagaagaataaactcttccagtacgcttcttcttctgggatt
ccttttgcaccccgcaccggacatcaggcaaaaggtgccgctactaccaagcccgcgggg
cccgagatgaagtag

DBGET integrated database retrieval system