KEGG   Fusarium graminearum: FGSG_06278Help
Entry
FGSG_06278        CDS       T01038                                 

Definition
(RefSeq) glucoamylase precursor
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
fgr  Fusarium graminearum
Pathway
fgr00500  Starch and sucrose metabolism
fgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FGSG_06278
Enzymes [BR:fgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     FGSG_06278
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 23553414
NCBI-ProteinID: XP_011324928
UniProt: I1RQD7
LinkDB All DBs
Position
3
AA seq 633 aa AA seqDB search
MYFVSTALLFGSFALQSVLGRPALQERQSSLDSFIKSESSVAIEQLLCNIGSDGCHSQGV
ASGVVIASPDTDDPDYFFTWTRDAALVFKYVIDRFINQYDAGLQIKIQQYIASQAKLQGV
SNPSGSLSDGSGLGEAKYEVDLSPFTGGWGRPQRDGPALRATAIITYANWLIDNGYTSTA
SDIVWPVVRNDLNYVAQYWNQTGFDLWEEVKGSSFFTTASQYRALTEGAALAKKLGKPGD
NYAAIAPQALCFLQTYWIPSGKYVDSNINVNDGRTGKDANSILTSIHNFDPSLSCDAATF
QPCSDKALANHKAVTDSFRSWNINKGISQGSAVSVGRYIEDVYYNGNPWYLATLAAAEQL
YDALYVWKQKGSITVSDVSLSFFKDLVSGISTGTYASDSATFKSITDAVSKYADGYVSIV
QKYVGDNGALAEQFDKNNGRPLSATDLTWSYAAFLSAADRRAGIVPPSWASGAAAVPQQC
GTQTVAGSYSLATATSFPPSQTPKGGAPSPTGTQPSTSPTASPTSCPIATSVAVTFVETV
TTNFGETIKIVGNIPALGNWDTSKAVALSASDYTSSNPVWKATISLTAGQDIQYKYINVK
KDGSVTWEKDPNRTYTVPKTCATKATKTDKWQS
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtacttcgtttctaccgctctcctcttcggctccttcgctttacaaagtgtcctgggc
cgaccggctttacaagaacgacaatcttctcttgattcctttatcaagtccgagagttcg
gttgctattgagcaactcctctgcaatatcggttctgatggttgtcactcccagggtgtt
gcttctggtgttgttattgcatctccagataccgatgaccctgactacttcttcacttgg
actagagatgctgctcttgtcttcaagtatgttatagataggttcatcaaccaatacgac
gctggtttgcagataaagattcagcaatacatcgcatctcaagccaagcttcagggagtc
tctaacccttctggatccctttccgacggctctggtctaggagaagccaaatacgaggtt
gatctcagcccctttactggtggttggggccgaccccagcgagatggcccagctcttcga
gccactgccataatcacttatgctaactggttgatcgataatggatacacttccaccgct
tctgacattgtttggcctgttgttcgtaacgatcttaactatgtagcccaatactggaac
caaaccggcttcgacttgtgggaggaggtcaagggaagttcattctttacaactgcttct
caataccgagctcttactgagggcgccgctctggccaagaagctgggaaagccaggagac
aactatgccgctatcgcaccccaggccctttgcttcttgcaaacctactggattccctct
ggcaaatatgttgattccaacattaatgtcaacgatggacgtactggaaaggacgcaaac
agtatcctcacatctattcacaacttcgacccttctctgagctgcgatgccgccactttc
caaccctgcagtgacaaggcactcgccaaccacaaggctgtcaccgattctttccgctca
tggaatatcaacaagggtatctcacagggaagtgccgtatctgttggaagatacatcgaa
gatgtctactacaacggtaacccctggtaccttgccaccctcgccgcggccgaacaactc
tacgatgcgctttatgtctggaagcaaaagggatccatcactgttagcgacgtttctctc
tcgttcttcaaggatcttgtctctggaatctccactggtacttacgctagcgactctgct
accttcaagagcatcaccgatgccgtctccaagtatgccgatggatatgtgagcatcgtc
cagaagtatgttggtgacaacggcgccttggcagagcagtttgacaagaacaacggacgt
cccctttctgccacggacctgacctggtcgtacgccgctttcctctctgcagctgaccgc
cgagccggtattgtccctccttcttgggcgagtggcgcagctgctgttcctcagcagtgt
ggaacccagaccgttgcaggctcatactcgctcgccactgctacctcgttcccaccatcg
cagacacccaagggtggtgctccatcccccacaggcactcagccttcgacttcacctact
gcttcacctacttcttgtcctatcgcaacttcagttgctgtcacctttgttgagacagtt
accaccaacttcggcgagaccatcaagattgttggcaatatccccgctcttggtaactgg
gacacttcgaaggctgttgctctgagtgcctctgactacacctcttccaaccccgtgtgg
aaggcaaccatctctctcactgctggacaagatatccagtacaagtacatcaatgttaag
aaggatggttcagtcacctgggagaaggaccctaaccgcacgtacactgttcccaagaca
tgcgctacaaaggccactaagacggataagtggcagtcttaa

DBGET integrated database retrieval system