KEGG   Fusarium graminearum: FGSG_06316Help
Entry
FGSG_06316        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
fgr  Fusarium graminearum
Pathway
fgr03030  DNA replication
fgr03410  Base excision repair
fgr03420  Nucleotide excision repair
fgr03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FGSG_06316
   03410 Base excision repair
    FGSG_06316
   03420 Nucleotide excision repair
    FGSG_06316
   03430 Mismatch repair
    FGSG_06316
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fgr03032]
    FGSG_06316
   03400 DNA repair and recombination proteins [BR:fgr03400]
    FGSG_06316
Enzymes [BR:fgr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FGSG_06316
    6.5.1.6  DNA ligase (ATP or NAD+)
     FGSG_06316
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     FGSG_06316
DNA replication proteins [BR:fgr03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    FGSG_06316
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     FGSG_06316
DNA repair and recombination proteins [BR:fgr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     FGSG_06316
   NER (nucleotide excision repair)
    Other NER factors
     FGSG_06316
   MMR (mismatch excision repair)
    Other MMR factors
     FGSG_06316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 23553451
NCBI-ProteinID: XP_011324970
LinkDB All DBs
Position
3
AA seq 833 aa AA seqDB search
MPSPTKKRKLNNGTKSTAPAKGLEYFFSKQKQNEAHSSKTPKIEENYGTSSDVPTEMTDE
ELARKLQAEWDQEVANTPHAALQEQTLQLPNEHNVSVSRDESPSPTSTRSKPSITLPTAL
NKPSTNNKAKPTLGLQAAGMAEDTTTTSIPFDESPLTFDPAEVLIEGDPASLLPAVSTNA
ISPPYISMELGLGGSAISKALRNACGLDNRALKAIYDKHGDAGDVAFEAKKKQSFTLRKP
KPLTIKAVYESLVKIASSQGQGSADTKQRIVDRLLQDARGGEESRFVVRTLCQHLRIGAV
KTTMLIALSRAFLLSRPPGADFPLKSVTDLAKLKKEDLAEVWGRAEEIVKACFARHPNYN
DIVPVLLEIGISEELLLRCGLALHIPLRPMLGSITRDLSEMLTKLQGRDFACEFKYDGQR
AQIHCDENGKVSIFSRHLEVMTDKYPDLVELIPKIRGEGVDSFIMEGEVVAVDRETGELK
NFQTLTNRARKDVDIGAITVDVCMFSFDLMHLNGQPLLDRPFRERRELLRSLFKEIPHHF
TWVKSLDATSADSESVLEFFKAAIDIKCEGIMVKILDNLPSALYLGEGEEEEPEGSDRIL
TPRSKSKGKGKSKGKKDETGEKVKTRRKPLLATYEPDKRLDSWLKVKKDYNSSFDTLDLI
PVAAWHGQGRKAKWWSPILMACRNEETGSLEAVCKCMSGFTDSFYKANRQFYDDGEDGGE
PQNTRTTQPSFVEYSGPRPDIWFEPQEVWEMAFADITLSPTYTAAIGLVSEERGLSLRFP
RFMMKRDDKSLEEASTNEFLAGLWRKQEAKAASKKENSGGAGAQVEDVEEADD
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgccgagtcccaccaagaaacggaagctcaacaacggcaccaaatcaacagcaccagct
aaaggccttgagtatttcttctcaaaacagaaacaaaatgaagctcattctagcaagacg
ccaaagatagaagaaaattacggcacatcaagtgatgttccgacggaaatgaccgatgag
gaattggccaggaaactccaggcggaatgggatcaagaggttgccaacactccccacgcg
gcgctccaggagcagactctgcaacttccgaacgagcacaatgtgtcagtatctcgagat
gaaagcccaagtccaacatcgaccagatccaagccgtcaatcactctcccaacggctttg
aacaagcctagtacaaacaacaaggcgaaacccacacttggccttcaagctgcgggcatg
gctgaggacacaacaacgacttcgatacccttcgatgagtcgcctctaacattcgatcca
gcagaagttctcatcgagggtgacccggcaagtctgttaccagcagtatcaaccaatgcc
atctcacctccctatatctctatggaattgggattgggtggttcggcaatatccaaagcg
ttgaggaacgcctgtgggctcgataaccgggccctaaaagctatttatgacaaacacggt
gatgctggagatgtagccttcgaagccaagaagaaacaaagttttactcttaggaaaccg
aaacctctcactattaaggctgtttacgagtctttggtaaagattgccagcagtcaagga
cagggcagtgcagataccaagcaaagaatcgtcgatcgtcttctccaagacgcccgtggt
ggagaagaaagccgatttgttgtgcgaacactttgtcaacatctacgaatcggcgctgtc
aagacgacaatgctgatcgccttatcacgagccttcttactctcgcgtccaccaggggcc
gatttccctctcaagtcggtaacagatttggccaaactcaagaaagaagacctagctgaa
gtttggggtcgggctgaggaaatagtcaaggcgtgctttgcgagacatccaaactataac
gatattgtcccggttcttcttgagattggcatttccgaggaactgctactacgatgcggc
cttgctctccatattcctctacgtccaatgcttggaagcattacgagagatctatccgag
atgctcacaaagttacagggaagagactttgcatgcgaattcaaatatgacggccagagg
gctcagatacactgtgacgagaatgggaaggtcagcatcttttctcggcatttggaagtc
atgacagacaaataccccgacttggtagagttgataccaaagatacgtggagagggtgtt
gacagtttcatcatggaaggtgaagttgtggctgttgaccgtgaaactggagagctcaaa
aattttcagacactcacaaacagagcaaggaaagacgttgacataggagctattacggta
gatgtctgcatgttctcgttcgatttgatgcatctgaacggccagccattgctagatcga
ccattccgagagagacgggagcttctacgatcgctattcaaggagataccgcaccatttt
acatgggtgaagagccttgatgctacgtctgcagactcggaatcagttctcgagttcttc
aaagctgccatagacatcaaatgcgaaggtattatggtgaaaatcctagacaacttgcct
tcggcgctatatttgggagagggagaagaagaggaaccagaaggatctgacagaatattg
acgccgagatcaaagtcaaaaggaaaagggaagtcaaaaggcaaaaaagatgaaactggg
gagaaagtcaaaacaagacgcaagcccttgttggcaacgtatgagccagataagcgactt
gactcctggctcaaggtcaagaaagactacaactcaagtttcgacacacttgatctcata
cctgtcgctgcctggcacggacaaggacgcaaggcgaaatggtggtcgcccatacttatg
gcttgtcgtaacgaggagacaggatcattggaagctgtgtgcaagtgcatgtctgggttc
acagatagcttctacaaggccaaccggcagttctatgacgatggcgaagatggtggtgag
cctcagaacacgagaactacccaacccagttttgtggaatactcaggcccaaggcctgat
atttggttcgagccgcaagaagtgtgggaaatggcatttgcggatattacgcttagtcca
acctacactgctgcgatcgggcttgtgagtgaagagagaggtttaagcttgaggtttcca
agatttatgatgaagagagatgataaaagtcttgaagaggcgagcacaaacgaatttttg
gctggtctttggcgcaagcaagaagcaaaggctgcttcgaagaaagagaacagcggcgga
gcaggggcacaggtagaagacgtagaagaagccgatgattag

DBGET integrated database retrieval system