Fusarium graminearum: FGSG_06922 Help Entry FGSG_06922        CDS       T01038                                  Name (RefSeq) hypothetical protein   KO K03094   S-phase kinase-associated protein 1 Organism fgr  Fusarium graminearum Pathway fgr03083   Polycomb repressive complex fgr04111   Cell cycle - yeast fgr04120   Ubiquitin mediated proteolysis fgr04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     FGSG_06922    04120 Ubiquitin mediated proteolysis     FGSG_06922   09126 Chromosome    03083 Polycomb repressive complex     FGSG_06922  09140 Cellular Processes   09143 Cell growth and death    04111 Cell cycle - yeast     FGSG_06922  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fgr04131]     FGSG_06922    04121 Ubiquitin system [BR:fgr04121]     FGSG_06922    03036 Chromosome and associated proteins [BR:fgr03036]     FGSG_06922 Membrane trafficking [BR:fgr04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     FGSG_06922 Ubiquitin system [BR:fgr04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      FGSG_06922    Cul7 complex      FGSG_06922 Chromosome and associated proteins [BR:fgr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      FGSG_06922   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      FGSG_06922 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ Trnau1ap Motif Other DBs NCBI-GeneID:  23554026 NCBI-ProteinID:  XP_011326589 UniProt:  V6RGI1 LinkDB All DBs Position 4:complement(1693652..1695302) Genome browser AA seq 169 aa AA seqDB search MSESTSPQKVWLASNDSANIEVDRVVAERSMLIKNMLEDVGDEITQGNPIPIPNVNEAVL RKVIEWCDHHRNDPPQAQDDESDARKKTTDIEEWDQKFMQVDQEMLFEIILASNYLDIKP LLDVGCKTVANMIKGKAPEEIRKTFNITNDFTPEEEEQIRRENEWAEDR NT seq 510 nt NT seq  +upstreamnt  +downstreamnt atgtctgagtctacatctcctcagaaggtttggctggcctctaatgacagcgcaaacatc gaagtcgaccgcgttgtcgccgagcgatcaatgctgatcaagaacatgctcgaggatgtt ggtgacgaaatcacccagggcaaccctattcctattcccaacgtcaacgaggcagtcctc cgcaaggttatcgagtggtgcgaccaccaccgaaacgaccctcctcaggctcaggatgat gaatccgacgctcgcaagaaaactaccgacatcgaggagtgggaccagaagttcatgcag gtcgatcaggagatgctcttcgaaattatcctcgcgtctaactacctcgatatcaagccc cttctcgacgttggatgcaagaccgtcgccaacatgatcaagggcaaggcacccgaggaa atccgcaagaccttcaatattaccaacgatttcactcccgaggaggaggagcagatccgc cgtgagaacgagtgggctgaggaccgctaa

DBGET integrated database retrieval system