KEGG   Fusarium graminearum: FGSG_07445Help
Entry
FGSG_07445        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
fgr  Fusarium graminearum
Pathway
fgr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    FGSG_07445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fgr03036]
    FGSG_07445
Enzymes [BR:fgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     FGSG_07445
Chromosome and associated proteins [BR:fgr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     FGSG_07445
   HMT complexes
    COMPASS/SET1 complex
     FGSG_07445
    COMPASS/SET1 complex (yeast)
     FGSG_07445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET_assoc SET
Motif
Other DBs
NCBI-GeneID: 23554522
NCBI-ProteinID: XP_011327217
UniProt: Q4I5R3
LinkDB All DBs
Position
4
AA seq 1217 aa AA seqDB search
MTRPPGASFAEFFPTAPKVKAQAQTRADQVRDRDRFKTASTPATINGTIDSTTGTAVLEA
DANVSLNGIVSASDTMPTQPDDTESPFTDIPNTVDSASSYSSAASSIFSTSTRHGAAATT
ASSRLPTSSLTPSAFKESPNSAPAAAKPDMSTYQTSDRAARQSSRNSPATGPNVSISNGL
PSNERIPARDPLPSVKGLRCTYDPLLDRVHNKSVSKSAKPTYEEFGREDDAPPPKDPRLA
RSDGRLGYINTDYYLPKSRLRTAPENIKPYPYDPKTSIGPGPPTQIVVTRYNPLIPFSKV
TAIFASFGEIAESSNKMHPETGSYLGFATIRYRDSKRPDRPPVSGIDAARRAVRARGIKV
DADIVRVEYDAEGRRSRRMLEEHLKREKEKFEKIEQERLALAAKAPPTGPKSGTAPAFTR
PPPTAPKGDSVPVLPSILPHMKKRLKSYGFEEIRVDKSGYFIVFRNSFTGSSEAERCFRA
VNHTEFFNYDMTMQLCLPRPRREDGSGRRRSSASSDRHTHAEPRYRDEKDRRRREEEADL
EEEKKQRAKNFDPVIEAVEVVRREMMEHLIRHIRTKVAAPALSDFLDPANHAAKRRKLNI
EHPDDLQEIPSIEDGNDSSRVGTPNSRADPIERRTGRLEPKALPRIRKTKVKGQAQKSAF
VDPFARKRPPVARNAFRSLHHRLRSLDSDAESDDDTDTRALLARETEEADSRPRSRMSTD
DEASKDDFVPWEQGEDDSMTEASFAIADTASTRKRKLVASLESVFKRQKKSDEELFGVNL
ETLDSEFKGREDSVDIIPEPETGDDVESRVSRSETPASAIGKPLKKRPGKRKKTKKASFE
EPEAAKTQPETEQQPGDEATEPSKVKQEKAEKTSMEELVPEKFDEKLFATEPLTPALELP
EGAKPDLPIFQGLTVSAQDIPDLAKLARRFNTKDIGNAELWLWTRNRIRELNSARRTLDS
PVTIGGYYVPNPTGCARTEGVKKILNSEKSKYLPHHIKVQKARQEREARNKLGRDAAAEA
ADAARIAAEKLVAKGNSRANRATNRRYVADLNDQKKTLGQDSDVFKFNQLKKRKKPVKFA
RSAIHNWGLYAMENIAKDDMIIEYVGEQVRQQISEIRENRYLKSGIGSSYLFRIDDNTVI
DATKKGGIARFINHSCMPNCTAKIIKVEGSKRIVIYALRDIALNEELTYDYKFEREIGST
DRIPCLCGTAACKGFLN
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcccgccaggcgcgagcttcgcggagttcttccccactgctcccaaggtaaaa
gctcaggctcagactcgcgcagaccaggttagggatcgcgatcgctttaaaacagcatcg
acaccagccactatcaacggcaccatcgactccacaacaggtacagctgtgctagaagcc
gacgcgaatgtcagccttaacggcattgtttcagcgtcggatactatgccaacacaacct
gacgacaccgaatccccattcacagatatccccaacaccgtcgactcggccagctcatat
agcagcgcggcctcatcgatattcagcacatccacccgccacggtgccgcggcgactaca
gcttcgtcccgtcttcccacttcgagcctcaccccaagcgccttcaaagaatctcccaac
tcggctccagccgccgcaaagccagatatgtctacgtatcagacctccgatcgggccgcg
agacagtcctctcgaaactcaccggccactggcccgaatgtctcgatatcaaacggactt
ccctccaatgagcgcattccggctcgagatcctttgccctccgtcaagggcctcagatgc
acctatgatccgctcctcgatcgagtacacaataagagcgtcagcaaaagcgccaaacca
acatatgaagagttcggtcgagaagatgacgccccccctcctaaagacccccgactggcc
aggtcggatggtcgcctcggttatatcaacaccgactactacctgcccaaatcacggcta
cgaacagcgcctgagaacatcaagccttatccctacgatcccaagacctccattggccct
ggcccacctacacagattgtcgtgacaagatacaatccgctcattcccttcagcaaggtg
acggctatctttgctagtttcggtgagatagcagaaagcagcaacaagatgcacccagag
acaggtagctatcttggatttgcgacaattcgatatcgagattctaagcgacccgatcgt
ccgcctgtctctggtattgatgcagctcgtcgtgcggtgcgagcccgtggaatcaaggtc
gatgcagacatcgttcgtgtagagtacgatgccgaaggtcgcaggagccggcgaatgttg
gaagaacaccttaagagggagaaggaaaagtttgagaaaatcgaacaggaacgactcgct
cttgcagccaaagcaccaccgaccggcccaaaatccggaacagctcctgccttcacgaga
cctcccccaacggccccgaaaggcgatagtgtcccagtcttacccagtatccttccccac
atgaagaaacgacttaagagttacggcttcgaggagatccgtgtcgacaaatcaggttat
ttcattgtctttcgtaattcgtttactggtagctcggaagctgagcgatgtttccgcgcc
gttaaccataccgaattcttcaactatgatatgaccatgcagctttgcttacctcgtcct
cgtcgagaggacggctccggtcgtcggcgatctagtgcgagctccgaccgacatacacac
gccgaaccacggtatcgtgacgaaaaggatagaagacgccgagaggaagaagcggatctt
gaagaggagaaaaagcagagagctaagaactttgaccctgtgatcgaggcggtggaagtt
gttcgacgtgagatgatggaacatcttatacggcatatacgcactaaggtcgcagcgcct
gctctctcggacttcctggaccccgccaaccatgctgccaagcgacgaaagctaaacatt
gagcatcctgatgacctacaagagatacccagcatcgaggatggcaatgacagctctcgt
gtgggaacgcccaactctcgcgctgacccaattgagcgccgaactggtcgtctcgaacca
aaggctcttccaagaattcgcaagaccaaggtcaagggccaggcacaaaagagtgccttt
gttgatccgtttgctagaaagcgtccacctgttgcccgcaacgccttccgttctctccat
caccgtctgagaagccttgacagtgatgctgaatccgacgacgacacggatacccgtgca
ttattagctcgagagacagaagaggctgattctcgcccgcgcagccgaatgagcaccgat
gatgaagcttccaaggacgatttcgtaccctgggaacaaggcgaggatgactcgatgacc
gaggccagtttcgccatagcagacacagcaagcactagaaaacgaaagttagtcgcctca
cttgaatcggtcttcaagcgccagaagaaatcggatgaggaactattcggtgtcaacctt
gaaacacttgattcggaattcaaggggcgcgaagactctgttgacatcattcccgagcca
gaaacgggcgacgacgtggaaagtagagtttcccgttctgagaccccggcctcggccatt
ggcaagcctctaaagaagaggcccgggaagaggaaaaagacgaagaaagcgtcatttgaa
gagcccgaggccgcgaaaacccaaccagagacagagcaacagcccggcgatgaagccaca
gaaccttccaaagttaagcaagagaaggcggagaaaacgtctatggaagaactggtcccg
gagaagtttgacgaaaagctctttgctactgagcccttgacacctgctcttgagttaccg
gaaggcgccaagcccgacttaccaatattccagggcttgacagtcagtgcccaagatata
cctgatctggccaaacttgccaggaggtttaatactaaggacatcgggaatgcggagttg
tggctgtggacccgcaaccgcatcagggagctcaactctgcaagacgcacgttggactct
cctgttactattggaggatattacgtgcccaaccctactggctgtgcccgtacggaaggt
gtcaagaagattctcaactcggaaaagtcgaagtacctccctcaccatatcaaggtgcag
aaggcaagacaagaacgggaggcccgcaacaagttgggtagagacgccgctgcagaagcc
gcggatgccgcaagaatcgctgccgagaaactggtcgctaagggaaactcacgagcgaat
cgcgctaccaaccgtcgctacgttgctgacctcaatgatcagaaaaagactcttggccag
gactccgatgtcttcaaattcaatcagctcaagaagcgaaagaagcccgtcaagtttgct
cgttcggctattcacaactggggtctgtacgccatggagaacattgcaaaggacgacatg
attatcgagtatgtcggcgagcaagttcggcagcagatctctgaaatccgcgagaaccga
tatctcaaaagtggcattggaagcagctatttgttccgtattgacgacaacaccgtcatc
gacgcaaccaagaagggtggcattgcgcgattcatcaaccacagttgtatgcctaactgt
actgccaagattattaaagttgagggaagcaagcgcattgtcatctacgcgttgcgcgac
attgccctgaacgaagagctgacgtatgattataaattcgagcgtgaaatcggcagtact
gaccgtattccttgtctctgcggcactgcggcctgcaagggcttcctcaactga

DBGET integrated database retrieval system