KEGG   Fusarium graminearum: FGSG_10347Help
Entry
FGSG_10347        CDS       T01038                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
fgr  Fusarium graminearum
Pathway
fgr00020  Citrate cycle (TCA cycle)
fgr00480  Glutathione metabolism
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
fgr01130  Biosynthesis of antibiotics
fgr01200  Carbon metabolism
fgr01210  2-Oxocarboxylic acid metabolism
fgr01230  Biosynthesis of amino acids
fgr04146  Peroxisome
Module
fgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fgr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FGSG_10347
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FGSG_10347
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    FGSG_10347
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     FGSG_10347
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 23557256
NCBI-ProteinID: XP_011319313
UniProt: I1S0V7
LinkDB All DBs
Position
1
AA seq 463 aa AA seqDB search
MPVAALASSVPRSLFSSSLRRVAYTSTTIRPVRASFGAIQTISPFAVRTMASSTQKIKVK
NPVVELDGDEMTRIIWQVIKDKFIHPYLDIDLKYYDLGLEYRDETNDQVTIDAAEAIKKY
SVGVKCATITPDEARVEEFKLKKMWLSPNGTIRNALGGTVFREPIVIPRIPRLVPGWKKP
IIIGRHAFGDQYRAKDAVLPGPGKLSMVYTPEGGQPEEIEVFQFKEGGGVAQTQYNTDES
ITGFAHASFKLAIDKELPLYMSTKNTILKKYDGRFKDIFQEIYETTYKKEFEAKKIWYEH
RLIDDMVAQMIKSSGGYIMALKNYDGDVQSDIVAQGFGSLGLMTSVLITPDGKTFESEAA
HGTVTRHYREHQKGNETSTNPIASIFAWTRGLIQRGKLDDTPDVVAFAEGLEQACIDTVD
IDGIMTKDLALATGKSERKDYATTNEYLDAVERRLKKTLKEKL
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtcgctgctctcgcctcttccgtcccgcgatctctattctcctcttcgctgcgc
cgtgtcgcttatacttccaccactatccgccctgttcgcgcttcattcggtgctatccaa
accatctccccatttgcagtccgcacaatggcttcctccactcagaagatcaaggtcaag
aaccccgtcgtcgaactcgacggtgatgagatgacccgcatcatctggcaggtcatcaag
gacaagttcatccacccctacctcgacatcgacctcaagtactatgatctcggtcttgag
taccgtgatgagaccaacgaccaggtcaccattgatgccgccgaggccatcaagaagtac
tctgtcggtgtcaagtgtgctaccatcactcccgatgaggctcgtgttgaggagttcaag
ctgaagaagatgtggctttctcccaacggcaccatccgaaacgctcttggcggtaccgtc
ttccgtgagcccattgttatcccccgtatcccccgtctggttcctggctggaagaagccc
atcatcattggccgtcacgcctttggtgaccagtaccgcgccaaggatgctgtcctgccc
ggtcccggtaagctctccatggtctacacccccgagggtggccagcccgaggagattgag
gtcttccagttcaaggagggtggtggtgttgcccagactcagtacaacaccgacgagtcc
atcactggattcgctcacgcttctttcaagctcgccattgacaaggagctccctctctac
atgagcaccaagaacaccatcctcaagaagtacgatggtcgcttcaaggacatcttccag
gagatctacgaaaccacctacaagaaggagttcgaggccaagaagatctggtacgagcac
cgtctcattgacgacatggtcgcccagatgatcaagagctccggtggttacatcatggct
ctcaagaactacgatggtgatgtccagtctgacattgtcgcccagggcttcggctctctc
ggtctcatgacctctgtcctcatcacacccgatggcaagaccttcgagtctgaggctgcc
cacggcaccgtcactcgccactaccgtgagcaccagaagggtaacgagacctccaccaac
cccattgcttccatcttcgcctggacccgtggtctcatccagcgtggtaagctcgacgac
acccccgatgtcgttgccttcgccgagggccttgagcaggcttgcattgacaccgtcgac
attgacggtatcatgaccaaggatcttgcccttgccactggcaagtctgagcgcaaggac
tatgccaccaccaacgagtaccttgatgctgttgagcgccgcctcaagaagactctcaag
gagaagctgtaa

DBGET integrated database retrieval system