KEGG   Fusarium graminearum: FGSG_13136Help
Entry
FGSG_13136        CDS       T01038                                 

Definition
(RefSeq) succinate dehydrogenase flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
fgr  Fusarium graminearum
Pathway
fgr00020  Citrate cycle (TCA cycle)
fgr00190  Oxidative phosphorylation
fgr01100  Metabolic pathways
fgr01110  Biosynthesis of secondary metabolites
fgr01130  Biosynthesis of antibiotics
fgr01200  Carbon metabolism
Module
fgr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fgr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fgr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:fgr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FGSG_13136
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    FGSG_13136
Enzymes [BR:fgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     FGSG_13136
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DUF600 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 23559943
NCBI-ProteinID: XP_011327122
UniProt: I1S8F8
LinkDB All DBs
Position
4
AA seq 650 aa AA seqDB search
MMASSMAMRKLALGPAFTRAARFPTRAFSTTRPVSRVITGNGPLRAKEASPFVSNKYAVI
DHEYDALVVGAGGAGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHEDD
WRWHMYDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTEDGKIYQRAFGGQSK
EYGKGGQAYRCCAAADRTGHALLHTLYGQSLRHKTNYFIEYFALDLIMQDGECRGVLAYN
QEDGTLHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPT
GIYGAGCLITEGSRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVG
AEKDHIYLQLSHLPAEILAERLPGISETAGIFAGVDVRKQPIPVLPTVHYNMGGIPTRYT
GEVLTVDEKGEDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHTIRDKFNP
GDALKPTAADAASDHIETLDKVRTADGPKSTAEIRLAMQKAMQTEVSVFRTQESLDEGVR
KMKEIDGMYSQVGMKDRSMIWNSDLVETLELRNLLTCAIQTAESAANRKESRGAHAREDF
PDRDDENWMKHTLSFQKQPHGKVDLSYRKVIGTTLDEAECKPVPPFKRTY
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgatggcttcttctatggcaatgaggaagttggccctcggccctgccttcacaagggct
gccaggttccctacccgagctttctctacaacccgacctgtttcccgagttattactgga
aacggtcctctacgagccaaggaggcctctccttttgtgagcaacaaatacgccgtcatc
gaccacgagtatgatgctctcgttgttggtgctggtggtgccggtctgcgagctgccttc
ggtcttgctgaggctggcttcaacactgcctgtatctccaagctcttccctacccgatct
cacactgtcgccgctcagggtggtatcaacgctgctctaggtaacatgcacgaggacgac
tggcgatggcacatgtacgataccgtcaagggttccgactggctgggtgaccaggacgct
attcactacatgacccgagaggctcccgcttccattatcgagcttgagaactacggctgc
cccttctcgcgaactgaggatggcaagatttaccagcgagctttcggtggtcagtcaaag
gagtacggaaagggtggtcaggcctaccgatgctgtgctgccgctgaccgaaccggccac
gcccttcttcacactctctacggccagtctctccgccacaagaccaactacttcatcgag
tacttcgccctcgacctgattatgcaggatggtgagtgccgcggtgtcctcgcctacaac
caggaggacggcactctgcaccgattcctcgccaaccacaccgtcctcgccactggtggt
tacggccgagcttacttctcctgcacatctgcccacacctgtactggtgacggtatggcc
atggttgcccgtgccggtctccccaaccaggatcttgagttcgtccagttccaccctact
ggtatctacggagctggctgcctgatcactgagggttctcgtggtgagggtggttacctc
ctcaactccgagggtgagcgattcatggagcgatatgcccctaccgccaaggatcttgct
tctcgtgatgtcgtttcccgatccatgaccatggagatccgtgagggccgtggtgttggt
gccgagaaggatcacatctacctccagctcagccatctccccgctgagatccttgctgag
cgtctgcccggtatctctgagaccgctggtattttcgctggtgtcgatgtccgcaagcag
cctattcccgttctccccaccgtccactacaacatgggtggtatccctacacgatacact
ggtgaggttcttaccgttgatgagaagggtgaggacaaggttgttcctggtctgtacgct
tgtggtgaggccgcttgtgtgtccgtccacggtgctaaccgtctgggtgccaactctctt
ctcgatcttgttgtctttggtcgtgccgtttcgcacaccattcgcgacaagttcaacccc
ggtgatgctctgaagcccaccgctgctgacgctgcttctgaccacatcgagaccctcgac
aaggtccgaaccgccgacggccccaagagcactgctgagatccgacttgccatgcagaag
gctatgcagaccgaggtcagcgtgttccgaacccaggagagtctggacgagggtgtccgc
aagatgaaggagatcgatggcatgtacagccaggttggcatgaaggaccgcagcatgatc
tggaactctgatctcgttgagactcttgagcttcgaaacctactgacttgcgctatccaa
accgccgagtctgccgccaaccgaaaggagtctcgtggtgctcacgcccgcgaggatttc
cccgaccgagatgacgagaactggatgaagcacacactctctttccagaagcagcctcac
ggcaaggtcgatctgtcctaccgaaaggtcatcggcaccaccctggacgaggccgagtgc
aagcccgtgccacctttcaagcgtacatactaa

DBGET integrated database retrieval system