KEGG   Allofrancisella guangzhouensis: SD28_03375Help
Entry
SD28_03375        CDS       T03527                                 

Definition
(GenBank) 3-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
fgu  Allofrancisella guangzhouensis
Pathway
fgu00061  Fatty acid biosynthesis
fgu00780  Biotin metabolism
fgu01100  Metabolic pathways
fgu01212  Fatty acid metabolism
Module
fgu_M00083  Fatty acid biosynthesis, elongation
fgu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:fgu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SD28_03375
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SD28_03375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fgu01004]
    SD28_03375
Enzymes [BR:fgu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     SD28_03375
Lipid biosynthesis proteins [BR:fgu01004]
 Fatty acid synthase
  Component type
   SD28_03375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT
Motif
Other DBs
NCBI-ProteinID: AJC48746
UniProt: A0A0A8E9A3
LinkDB All DBs
Position
719151..719642
Genome map
AA seq 163 aa AA seqDB search
MSQFDENNKQIDVMGIRKILPHRYPFALLDKIVDWNVEERSIIAQKNVTINEDFFNGHFP
EFPVMPGVLIVEAMAQATAILGELMAETLFAHVVAKAGGGRRTFMLAGIDKVRVKRPVVP
GDVLIIESRMVKQKNIICTAESVAKVDGQIVCSAELMAAYKDY
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatttgatgaaaataataagcaaatagatgtgatgggaattaggaaaattttg
ccacataggtatccttttgctcttttagataaaattgttgactggaatgttgaggaaaga
agtataatagctcaaaaaaacgttacaattaatgaagatttttttaatggacattttccg
gagtttccggtaatgccaggtgttttaattgttgaagctatggctcaagctacagctata
ttaggtgagttaatggctgaaacattatttgcacatgttgttgctaaagctggtggtggt
agaagaacttttatgcttgcaggtatagataaggttagagtaaaaagaccggttgtccct
ggcgatgtactaattattgaatcacgaatggttaagcaaaagaatattatatgtacagct
gagtctgtagcaaaagttgatggacaaatagtttgttcagcagagttaatggcagcttat
aaggattattaa

DBGET integrated database retrieval system