KEGG   Allofrancisella guangzhouensis: SD28_05580Help
Entry
SD28_05580        CDS       T03527                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fgu  Allofrancisella guangzhouensis
Pathway
fgu00240  Pyrimidine metabolism
fgu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fgu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SD28_05580
Enzymes [BR:fgu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SD28_05580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 DUF4280 FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AJC49141
UniProt: A0A0A8EAF9
LinkDB All DBs
Position
complement(1187254..1187847)
Genome map
AA seq 197 aa AA seqDB search
MAKLYFRYSSMDAGKTLDLLKVAYNYEDKGKHPLILTSAIDKRAGLNKVKSRMGIDQDAY
SLTDNDNIYDFVEEYHHKKTVDCILIDEIHFFTVKQVWQLSNIVDDLDIPVICYGLRTNY
LGQPFETAALLLSIADTLEEVKTICHCGKKASFNMIVQDGKALKYGNPIVIDDDSLKKIN
TRYFSVCRKHWKEGVYG
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagttatattttagatactcatctatggatgctggtaaaacactggacttactt
aaagttgcttataattatgaagataaaggcaagcatcctcttatcttaacatctgcaata
gataaaagagcaggtcttaataaagttaaatcccgcatgggtatagatcaagatgcttat
tctttgacagataatgataacatttatgattttgtagaagaatatcatcacaaaaaaact
gtagactgcatactgatagatgaaattcatttttttacagttaaacaggtgtggcagtta
tctaatattgtagatgatttagatatccctgtaatttgttatggtttacgtactaattat
ttaggacagccttttgaaacagcagccttacttttgtctatagctgatacattagaggag
gttaaaacaatttgtcattgtggtaaaaaagcaagttttaatatgatagttcaagatgga
aaagccctaaaatatggtaaccctatagttattgatgatgattctttaaaaaagattaat
acgagatatttttctgtatgtaggaagcattggaaagaaggcgtttatgggtag

DBGET integrated database retrieval system