KEGG   Francisella halioticida: CDV26_10735Help
Entry
CDV26_10735       CDS       T04972                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
fha  Francisella halioticida
Pathway
fha00020  Citrate cycle (TCA cycle)
fha00190  Oxidative phosphorylation
fha00650  Butanoate metabolism
fha01100  Metabolic pathways
fha01110  Biosynthesis of secondary metabolites
fha01120  Microbial metabolism in diverse environments
fha01130  Biosynthesis of antibiotics
fha01200  Carbon metabolism
Module
fha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDV26_10735 (sdhB)
   00650 Butanoate metabolism
    CDV26_10735 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CDV26_10735 (sdhB)
Enzymes [BR:fha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CDV26_10735 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     CDV26_10735 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_4 Fer4_7 Fer4_9
Motif
Other DBs
NCBI-ProteinID: ASG68792
UniProt: A0A2Z2L6Z6
LinkDB All DBs
Position
complement(2025048..2025749)
Genome map
AA seq 233 aa AA seqDB search
MDVRFKIYRYNPEVDNKPYYDEYTVSVENEGVKVLTALELIKEQDPTLAMRRSCREGVCG
SDGMNINGKNRLACITSIGELRQPIKVNPLPGLPVVRDLIVDMKQFYKNYEKVKPYLIND
DELPVKERLQSPEDRAKLDGLYECVLCACCTTSCPSFWWNPDKFIGPSGLLQAYRFIADS
RDTATNERLEDLKDPFSLFRCRTIMNCVSVCPKGLNPTEAIGKIRSALLKKNV
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atggacgtaagatttaaaatttatagatataatccagaagttgacaataagccttattat
gatgaatatacagtttcagtagaaaatgaaggtgttaaggttttaactgctttagagctt
attaaagaacaagatcctactcttgcaatgagaaggtcatgtcgagaaggcgtttgcggt
tctgatggtatgaatatcaatggtaaaaatcgtttagcttgtattacttctatcggtgaa
ttaagacaacctatcaaggtaaatccattgccgggcctgcctgtggttagagatttgatt
gttgatatgaagcaattttacaaaaactatgagaaagttaagccttatcttataaatgat
gatgagcttcctgttaaagagagattacagtctccagaggatagagctaaattagatggt
ttgtatgagtgtgttttatgtgcttgctgtactacatcttgtccatctttttggtggaac
cctgataagtttataggcccgtctggacttttacaggcttatagatttattgctgactca
agagatacggctactaatgagagacttgaagatttgaaagacccgtttagtctatttaga
tgtagaactattatgaattgtgtttcagtatgtccaaaaggattaaatcctacagaagca
attggtaagataaggtctgcattattaaaaaaaaatgtgtaa

DBGET integrated database retrieval system