KEGG   Francisella halioticida: CDV26_10740Help
Entry
CDV26_10740       CDS       T04972                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
fha  Francisella halioticida
Pathway
fha00020  Citrate cycle (TCA cycle)
fha00190  Oxidative phosphorylation
fha00650  Butanoate metabolism
fha01100  Metabolic pathways
fha01110  Biosynthesis of secondary metabolites
fha01120  Microbial metabolism in diverse environments
fha01130  Biosynthesis of antibiotics
fha01200  Carbon metabolism
Module
fha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CDV26_10740 (sdhA)
   00650 Butanoate metabolism
    CDV26_10740 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CDV26_10740 (sdhA)
Enzymes [BR:fha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CDV26_10740 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     CDV26_10740 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO Thi4 GIDA FAD_binding_3 HI0933_like FapA NAD_binding_8 Pyr_redox_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ASG68793
UniProt: A0A2Z2LCP3
LinkDB All DBs
Position
complement(2025767..2027560)
Genome map
AA seq 597 aa AA seqDB search
MSIATQEFDAIVIGAGGAGLRAAFQLSQSGFKTAVVSKVFPTRSHTVAAQGGIAAALGNI
KYDDDLPSDDWKWHMYDTVKGSDYIGDQDAIEYMCEHAPQSIIELEHMGMPFSRLEDGKI
YQRAFGGMSRNFDPANQAKRTCAASDRTGHALLHTLYQGNLAHKTNFYTEWFAVDLVKAD
DGSVSGVIALCIETGETVFLKSKLTILATGGAGRIYESSTNAYINTGDGMGLALRADIPL
QDMEFWQFHPTGIAGAGVLVTEGCRGEGGILRNKNGERFMERYAPNAKDLACRDVVSRAS
QQEIMEGRGDTFGGSNCVWLDLTHLGEDVIDERLPTVRELARTFAGVDPVEKPIPVVPTC
HYQMGGIPTNKHGQVITQKNGEDEIIGGLYAVGECASVSVHGANRLGSNSLLDLVVFGRA
AGMHAEQSLKEGMTLKETSQENVEKATARIKKWDSSEDRGCKEKISELRKELQQTMQQYF
SVFRQESTMKEGLDKLYKLRERLENAVLEDNSRVFNMMRIEALELDNLMLTAVSTAKLAL
ERTESRGAHSRVDYPDRDDKNWMKHTLYSLDEDKTSSRGVNMSPTKVKAFQPAERKY
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagtatagctacacaagaatttgatgctattgttattggtgctggtggagcaggtttg
agagcagcgtttcaattatcccagtctgggtttaaaactgctgttgtttctaaagttttt
cctacaagatctcatacggttgcagcccaaggtggtattgcagcagctttaggaaatatt
aagtatgatgatgatcttccttctgatgactggaagtggcacatgtatgatacagtaaaa
ggatctgactatatcggtgatcaagatgctattgagtatatgtgtgaacatgcaccacag
tctattatagaattagagcatatgggcatgcctttttcacgtttagaagatggtaaaata
tatcaacgtgcctttggtggtatgtcaagaaattttgatccggcaaatcaagcaaaaaga
acatgtgctgcttctgatagaacagggcatgcattattacatactctttatcaaggtaat
ttagcacataaaactaatttttatactgaatggttcgctgttgatttagttaaagctgat
gatggtagtgtatctggtgttattgctttatgtatagaaactggtgagacagtgttttta
aagtcgaagttaactatattagcaactggtggagcaggacgtatttatgagtctagcact
aatgcgtatattaatactggagatggtatggggttagccttaagagctgatattcctctt
caagatatggagttttggcaatttcatcctactggtattgctggtgctggtgttttagtt
actgaaggatgtcgtggtgaaggaggtattctgcgcaataaaaatggtgagaggtttatg
gagcgttatgctcctaatgctaaagatcttgcctgtcgtgacgttgtatcaagagcctct
caacaggaaattatggaaggtcgtggtgatacattcggcggctcaaactgtgtatggtta
gatttaacacatcttggtgaagatgtgattgatgagagactacctacagttagggaactt
gctagaacatttgctggtgtagatcctgtagagaaaccaattccagtggtgccaacatgc
cactatcaaatgggaggtattccaactaataagcacgggcaggttattacgcaaaaaaat
ggtgaagatgaaattattggcggtctatatgctgttggtgagtgtgcatcagtgtctgta
catggagctaatagattaggtagtaactctttgcttgacttagttgtgtttggtagggca
gcaggaatgcatgctgaacaaagcttaaaagaaggaatgactttaaaagaaacttctcaa
gaaaatgttgagaaagctactgctagaattaagaaatgggactcttctgaggatagaggt
tgcaaagaaaaaatctctgaacttagaaaagaacttcagcaaacaatgcagcagtacttc
tcagtgtttaggcaagaaagtacaatgaaagaaggcttagataaattatataagctgaga
gaaaggttagaaaatgctgtcttagaagataattctagagtatttaatatgatgagaata
gaggctttagagcttgataatctgatgttaacagcagtttctacagctaagcttgcttta
gaaagaacagagtcaagaggagctcattcaagagttgactatcctgatagggatgataaa
aactggatgaagcacacgttatactccttagatgaagataaaacatcctctcgtggtgta
aatatgtctccaactaaagttaaagcttttcaaccagcagaacgtaagtattaa

DBGET integrated database retrieval system