KEGG   Francisella hispaniensis FSC454: FSC454_03700Help
Entry
FSC454_03700      CDS       T04700                                 

Definition
(GenBank) ribonuclease E
  KO
K08300  ribonuclease E [EC:3.1.26.12]
Organism
fhi  Francisella hispaniensis FSC454
Pathway
fhi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fhi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    FSC454_03700
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fhi03019]
    FSC454_03700
   03009 Ribosome biogenesis [BR:fhi03009]
    FSC454_03700
Enzymes [BR:fhi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.12  ribonuclease E
     FSC454_03700
Messenger RNA biogenesis [BR:fhi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     FSC454_03700
Ribosome biogenesis [BR:fhi03009]
 Prokaryotic Type
  rRNA processing factors
   FSC454_03700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_E_G S1 KH_1 Anti-TRAP Flu_C_NS1
Motif
Other DBs
NCBI-ProteinID: APD50295
UniProt: A0A153JSJ1
LinkDB All DBs
Position
complement(762243..764903)
Genome map
AA seq 886 aa AA seqDB search
MKRILINSKSGEETRIATLDNGKLIDLDIESVDREQKKANIYKGYISRIEPSLNAIFVNY
GEEKNGFLPFKEVSEYYLKDVPNGENIAPLLSEGQELIVQIDKEERGDKGAALTTFITLA
GSYMVLLPNNPEGGGISRRVEGEDRERLKKYLKELNIPKNMSVIARTACVECSFEELKHD
FDTLVELWESISKAYHRIKKPALLHKESDIIVRTVRDHLKEDVKEIIVDSKECFEDVKRQ
LSLLRQSFDINKVKLYNEELPLFAQFGIDQQIENAYKREIRLPSGGSIVIDTTEALVAID
VNSSRANKAEDVETTAFKTNLEATEEVARQLRIRDLGGLVIVDFIDMSFYPNRKQVEEKL
MEALQQDRARIQMSRISKLGLVEISRQRLSSSINESVMQKCPRCDGHGFIKTTQATALTI
LRKIRAEAIKEDTNEIRVQVPVDIAAYILNEKRDSIIEIERISQVKVMIIPNFNMESPKF
QMQRIWGTSYKSNRTSSELIEDVYNIEIPKAGKKKVAAVDLNQAIENQVTNQATSSIQEQ
NPQTDTQINTAMQNDKKQDAVTQQTNKKGFFAKLFSSIFATDSKTTQQANNPGQKQQNKE
QSFQKQQQNKLQKDNNQRNERNNNNKNERNKNRNNKGAKPQVAQENKPQKDNNQRNDINA
SSNNNDKNERNKTKPNSDKFDKKSNNRNNRSNNLNLNNAEEVIDITQLKYQNQTAVAKTD
NVKKVISKNPDEFISVMVKDVLENYDSLKDDGATKIATQEKIKTNKYLKFDTVSVDTEIA
LLNEVAKSNQSSEAEQISAVAEESLSVVDKVDEITITEAVVEQEKPAKVVKEINQTSEAK
PKKEKQTTTRNNKKEKPAEKEIKQNQAKPEYINYSPAIDFESQALI
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaatactaataaacagcaaaagtggtgaagaaacaagaattgccaccttagat
aatggcaaactaatagatttagatattgagagtgttgatagagaacaaaaaaaagcaaat
atttacaaaggttatatttcaagaattgagccaagtttaaatgctatatttgttaattat
ggcgaagaaaaaaatggttttttaccatttaaagaagtatcagagtattacctaaaagat
gttccaaatggtgaaaatatcgcacctttgctttcagaaggacaagaattaattgttcaa
atagataaagaagaacgaggcgataaaggcgcggcattaactacatttattaccttggct
ggttcatacatggtgttactgccaaataaccctgagggtggcggtatctctcgtcgtgtc
gaaggtgaagatagagaaagattaaaaaaataccttaaagaattaaatatcccaaaaaat
atgagcgtaatagcaagaactgcttgtgttgaatgctcttttgaagaattaaaacatgat
tttgatactctagttgaattgtgggaatctatttctaaagcttatcatagaatcaaaaaa
ccagcactattacataaagagagtgatattattgttagaacagtgagagatcacttaaaa
gaagatgttaaagaaattatcgttgattctaaagaatgttttgaagatgtcaaaagacag
cttagcctactaagacaaagctttgatataaataaagtaaaactatacaacgaagaatta
cctttatttgctcagtttggcattgatcaacaaatagaaaatgcttataaaagagaaatt
cgcctaccatctggtggctctatcgtaatagatactacagaagcacttgtagcaatagat
gtaaactcatctcgcgctaacaaagctgaagatgtagaaactacagcatttaaaactaac
ctagaggctacagaagaagtcgctcgtcaacttagaattagagatttaggtggtcttgtt
atagttgactttattgatatgtcattctacccaaatagaaaacaagtcgaagagaaatta
atggaagcgctacagcaagatagagcacgcatccaaatgtcacgtatttccaaacttgga
ctagttgaaatatcaagacaacgcttaagctcttcaattaacgaaagtgtaatgcaaaaa
tgtccacgttgcgatggtcatggttttatcaaaactactcaagctacagcacttactatc
ctacgtaaaatcagagcagaggctatcaaagaagataccaacgaaattcgtgtccaagtt
cctgtagatatcgcagcgtatatactaaatgaaaaaagagatagtattattgagattgag
agaatttctcaagttaaagttatgattatccctaactttaatatggaatcaccaaaattc
caaatgcaaagaatttggggtactagctataaatcaaatcgtactagctcagaattaata
gaagatgtttataacattgaaattcctaaagctggtaagaaaaaagttgcagctgtggat
ttaaatcaagctatagaaaatcaagttactaatcaagctactagcagtattcaagagcaa
aatcctcaaacagatactcaaataaatacagctatgcaaaatgataaaaaacaagatgct
gtgactcaacaaactaataaaaaaggcttctttgctaaactttttagtagtatatttgca
actgattcaaaaactactcaacaagctaataatccaggtcaaaaacaacaaaacaaagaa
caaagcttccaaaagcagcaacaaaataaactacaaaaagacaataaccagcgtaatgaa
cgcaacaacaataataaaaatgagcgtaataaaaatagaaataataaaggcgcaaaacca
caagtggctcaagaaaataagccacaaaaagataataaccagcgcaatgatatcaatgct
agcagcaataataatgataaaaacgagcgtaataaaactaaaccaaacagtgataagttt
gataaaaaatcaaataaccgcaacaacagaagcaataacctaaatctaaacaatgctgaa
gaagttattgatattacgcaacttaagtatcaaaatcaaacagctgttgccaaaacagat
aatgttaaaaaggtgatttcgaagaatcctgatgagtttatctctgtaatggtcaaagat
gtcttagaaaattatgatagcctaaaagatgatggcgctacaaagatagctacccaagag
aaaattaaaactaacaaatacttaaagtttgatactgtatctgtagatactgaaatagct
cttcttaatgaagtcgctaaatcaaatcaatctagtgaagctgagcaaatatcagctgta
gcagaagaatctttaagtgttgttgataaagttgatgagataacaataacagaggctgta
gtagagcaagaaaagccagcgaaagtggttaaagaaattaatcaaactagtgaagctaaa
cctaaaaaagaaaaacaaactactacaagaaataataagaaagaaaagccagctgaaaaa
gaaattaagcaaaatcaagctaagcctgaatacataaactattcaccagcaattgatttt
gaatctcaagcactaatatag

DBGET integrated database retrieval system