KEGG   Francisella hispaniensis FSC454: FSC454_03805Help
Entry
FSC454_03805      CDS       T04700                                 

Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
fhi  Francisella hispaniensis FSC454
Pathway
fhi00061  Fatty acid biosynthesis
fhi00780  Biotin metabolism
fhi01100  Metabolic pathways
fhi01130  Biosynthesis of antibiotics
fhi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:fhi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    FSC454_03805
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    FSC454_03805
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    FSC454_03805
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fhi01004]
    FSC454_03805
Enzymes [BR:fhi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     FSC454_03805
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     FSC454_03805
Lipid biosynthesis proteins [BR:fhi01004]
 Fatty acid synthase
  Component type
   FSC454_03805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: APD50315
UniProt: A0A153JSL5
LinkDB All DBs
Position
779395..780177
Genome map
AA seq 260 aa AA seqDB search
MGFLAGKKILITGLLSNKSIAYGIAKAMHREGAELAFTYVGQFKDRVEKLCAEFNPAAVL
PCDVTSDQEIKDLFVELGKVWDGLDGIVHSIAFAPRDQLEGNFIDCVTREGFSIAHDISA
YSFAALAKEGRSMMKNRNASMVALTYIGAEKAMPSYNTMGIAKASLEATVRYTALALGED
GIKVNAVSAGPIKTLAASGISNFKKMLDYNAMVSPLKKNVDIMEVGNTVAFLCSDMATGI
TGEVVHVDAGYHCVSMGNVL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctagcaggaaaaaaaatattaatcacaggacttttaagtaataaatcaatt
gcttatggtatcgccaaagctatgcatagagaaggagctgagcttgcttttacttatgtt
gggcaattcaaagatagagtagaaaaattatgcgcagaattcaatccagcagcggtttta
ccttgcgatgtgacttctgatcaagagattaaagatttatttgtagagttaggtaaagtt
tgggatggtctagatggtattgttcattctatagcttttgcgccgcgtgatcagttggag
ggtaattttattgactgtgtaactcgtgaaggttttagtattgctcatgatatcagtgct
tattcttttgcagcactagctaaagaaggtcgtagtatgatgaagaatcgtaatgcttct
atggttgcacttacttatattggagcagaaaaagctatgccaagttataacactatgggt
attgctaaagcatctctagaagctacagttagatatacagctttagctttaggtgaggat
ggtattaaggtaaatgctgtatcagctggtcctatcaaaactctcgcagcttctggtata
tcaaactttaagaagatgcttgattataatgctatggtttctccacttaagaagaatgtt
gatattatggaagttggtaatactgtggcgtttttatgctcagatatggcaactggtatc
actggagaagttgtccatgttgatgctggatatcattgtgtctctatgggtaatgttctt
taa

DBGET integrated database retrieval system