KEGG   Fusobacterium hwasookii: RN87_04515Help
Entry
RN87_04515        CDS       T04183                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fhw  Fusobacterium hwasookii
Pathway
fhw00473  D-Alanine metabolism
fhw00550  Peptidoglycan biosynthesis
fhw01100  Metabolic pathways
fhw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fhw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    RN87_04515
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RN87_04515
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    RN87_04515
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fhw01011]
    RN87_04515
Enzymes [BR:fhw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     RN87_04515
Peptidoglycan biosynthesis and degradation proteins [BR:fhw01011]
 Precursor biosynthesis
  Amino acid ligase
   RN87_04515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK ATP-grasp_4 ATP-grasp CPSase_L_D2 ATPgrasp_ST AhpC-TSA GARS_A TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ALQ39805
UniProt: S4VNS9
LinkDB All DBs
Position
962599..963462
Genome map
AA seq 287 aa AA seqDB search
MKIAVFMGGTSSEKEISLKSGAAVLESLQKQGYDAYGVILDEKNQVSAFVDNDYDLAYLV
LHGGNGENGKIQAVLDILGKKYTGSGVLASAITMDKDKTKQIAQSIGIRTPKAYKTVETI
ERFPVIIKPVDEGSSKGLFLCNNKEEAEEAVKKLARPIIEDYIVGEELTVGVLNGEALGV
LKIIPQADILYDYNSKYANGGSIHEFPAKIENKSYKEAMKIAEKIHSEFGMKGISRSDFI
LSEGELYFLEVNSSPGMTKTSLIPDLATLKGYTFDDVVKMTVETFLK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcagtttttatgggagggacttcctcagaaaaagaaatttctttaaaaagt
ggtgcagcagtattagaaagtttacaaaaacaaggttatgatgcttatggagttatttta
gatgaaaaaaatcaagtatcagcctttgttgataatgattatgatctagcatatttagtt
ttacatggtggaaatggagaaaatggtaagatacaagcagtattagatatcttaggaaaa
aaatatactggttcaggagtccttgctagtgcaataactatggataaagataaaactaaa
caaattgcacaaagcattggaataagaactccaaaagcatataaaacagttgaaacaatt
gaaagatttccagttataataaaaccagttgatgaaggttctagtaagggattattctta
tgtaataataaagaagaagcagaagaagctgtaaaaaaattagcaagaccaataatagaa
gactatattgttggagaagaattaacagttggtgtcttaaatggagaagctttaggagtt
ttaaaaataattccacaagcagatatattatatgattacaattcaaaatatgctaatgga
ggttcaatccatgaatttccagcaaaaatagaaaataagtcatataaagaagctatgaaa
atagcagagaaaattcatagtgagtttgggatgaaaggaatttcaagaagtgattttata
ctaagtgaaggagaactttatttcttagaagttaattcttcaccaggaatgacaaaaaca
agtttaattcctgatttagcaactcttaaaggctatacctttgatgatgttgtaaaaatg
acagttgaaacatttttgaaataa

DBGET integrated database retrieval system