KEGG   Fervidobacterium islandicum: NA23_05995Help
Entry
NA23_05995        CDS       T04215                                 

Gene name
porA
Definition
(GenBank) pyruvate ferredoxin oxidoreductase
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
fia  Fervidobacterium islandicum
Pathway
fia00010  Glycolysis / Gluconeogenesis
fia00020  Citrate cycle (TCA cycle)
fia00620  Pyruvate metabolism
fia00640  Propanoate metabolism
fia00650  Butanoate metabolism
fia00680  Methane metabolism
fia01100  Metabolic pathways
fia01120  Microbial metabolism in diverse environments
fia01130  Biosynthesis of antibiotics
fia01200  Carbon metabolism
Module
fia_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fia00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NA23_05995 (porA)
   00020 Citrate cycle (TCA cycle)
    NA23_05995 (porA)
   00620 Pyruvate metabolism
    NA23_05995 (porA)
   00640 Propanoate metabolism
    NA23_05995 (porA)
   00650 Butanoate metabolism
    NA23_05995 (porA)
  Energy metabolism
   00680 Methane metabolism
    NA23_05995 (porA)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    NA23_05995 (porA)
Enzymes [BR:fia01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     NA23_05995 (porA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AMW32859
UniProt: A0A1B0VKS0
LinkDB All DBs
Position
complement(1283862..1285031)
Genome map
AA seq 389 aa AA seqDB search
MPLKQAITGAEAIAYAMKQINPDVVAAYPITPQTPVVEYFAKYVADGVVDTEMIPVESEH
SAMSAVVGAAAAGARAFTATASVGLALMHEVVFIAASLRLPIVMAVANRALSGPINIHCD
HSDAMAERDSGWIQLWAENAQEAYDFTVMAYRIAEHPDVRLPVMVNFDGFIISHGVEVVE
TLDDEVVKNFVGKPIKMYPLLDTSKPVTYGPLDLYDYYFEHKRQQIEAMKHVPKVFKEVA
EEFAKISGRKYDLFDEYMVDDAEYIMVALGSTAGTIKHTINELRAEGKKVGLVKPWVFRP
FVKAELQRILNARKGVIVLDRAASFGAEAPLYEAVKSALYEVALRPQMGSYVYGLGGRDI
TPEHIRQAFEDAFKGNLIADEERYLGLRE
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaacaagcaattacgggtgcggaagcgatagcttacgcgatgaaacagata
aatccagatgtcgttgcggcatatccgatcacaccgcaaacacctgttgttgaatatttt
gcaaaatacgtagccgatggtgttgtcgatacggaaatgattcctgttgaaagtgaacac
tctgcaatgagtgctgttgttggtgcagctgctgcaggtgcaagagcgtttacagcaacc
gcttccgttggtcttgcgcttatgcacgaagtggtctttatcgcagcatccttgaggctg
ccgatagtaatggcagttgccaacagggcactctcaggtcctatcaacatccactgtgac
cacagcgatgcaatggctgaaagagatagcggttggattcaactgtgggcggagaacgct
caggaagcctacgactttaccgttatggcatacagaattgcggagcatccagatgtaagg
ctgccggtaatggtcaatttcgacggattcattatctcacatggtgttgaagtagttgaa
acactcgatgatgaagttgtaaagaactttgtcggaaagccaataaagatgtacccatta
ctcgatacatctaaacccgtaacttacggtccccttgacctttacgattactactttgaa
cacaaaagacagcaaatcgaagcgatgaagcatgttccgaaggtattcaaagaagtagca
gaagagtttgcgaagatttcagggagaaagtacgacttgttcgatgaatacatggttgac
gatgcagaatacataatggttgcacttggctctacggctggaacgattaaacatacgatc
aacgaactcagagccgaaggtaagaaggttggcttggtcaaaccctgggtattcagaccg
tttgttaaagccgagctacagagaatacttaacgcaagaaaaggtgttatcgtacttgat
agggcagcatcattcggtgcggaagctccactttatgaggcagtcaaatctgcactctat
gaggtagcactaagacctcaaatgggtagttatgtctatggtctcggtggtagggatata
acaccagaacacattagacaagcattcgaagatgccttcaaaggcaatcttatcgccgat
gaagaaagataccttggattgagagaataa

DBGET integrated database retrieval system