KEGG   Fervidobacterium islandicum: NA23_08100Help
Entry
NA23_08100        CDS       T04215                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
fia  Fervidobacterium islandicum
Pathway
fia00260  Glycine, serine and threonine metabolism
fia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NA23_08100 (tdh)
Enzymes [BR:fia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     NA23_08100 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AdoHcyase_NAD AlaDh_PNT_C 2-Hacid_dh_C FAD_binding_3 NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AMW33776
UniProt: A0A1B0VM03
LinkDB All DBs
Position
complement(1705426..1706463)
Genome map
AA seq 345 aa AA seqDB search
MRAIMKKVAGPGLVMEQVKRPTQEDLGPRDVLVKVRRASICGTDVHIYKWDEWSQSRIIP
PLITGHEMAGEVVAVGSAVTQVKVGDLVAAETHIPCEHCYQCKTGRMHVCKNLKILGVDT
NGIFAEYAIIPETVLWRFSPEIPLDYASVMEPFGNAIHTASVTNLLGKTVLITGAGPIGL
MAIQVAKVAGASTVIVSEVDPLRIEMAQENGADVVINPAEKDLVKEVYKLLGDGVDVLLE
MSGNRKAFEDGLKCVTMGGEVSVLGIFGGKIDINFDALITMRGLTVYGITGRRMFETWRI
ADELLRTKKVDLSKVVTHVLPFNEWEKGFELMLNKQCGKVVLNLD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagagcgataatgaaaaaggtagctggtcctggtttggtgatggagcaggtcaaaagg
cccactcaagaagacttgggacctcgagatgtgcttgttaaggttagacgtgcttcaatt
tgtggaactgatgttcacatatacaaatgggatgaatggtcacaatctcgtataattcca
ccgctcatcactggtcacgagatggcaggtgaagttgtagcagttggcagtgctgtaact
caagtgaaggttggtgatttggtcgcagcggaaactcatattccttgtgaacactgctat
caatgtaaaactggaaggatgcacgtgtgtaagaatctaaaaatcttgggtgttgatacg
aatggtattttcgcagaatatgctatcatcccagaaaccgtcctttggagattctcgccc
gaaatcccattggattacgcctctgttatggaaccgttcggaaacgcaattcatacggca
tccgtcacaaacttacttggaaagacggtacttataaccggtgcaggcccgataggtttg
atggcgatccaagtggcaaaagttgcaggtgcaagtactgtgatcgtttcggaagttgac
ccactgagaatagaaatggcgcaagaaaacggtgccgatgttgtgataaatcctgcggaa
aaagatttggtcaaggaagtttataaactactcggcgatggagtcgacgttttgctcgaa
atgagtggtaacaggaaagcgtttgaggacggtttaaaatgcgtcacgatgggcggagag
gtatctgttcttggtatattcggtggaaagatcgatattaattttgacgcgttaatcacc
atgagaggacttacggtctatggtataacaggtagaaggatgttcgagacatggagaata
gctgatgagcttttacgaacaaagaaagttgacctttcaaaagttgttactcacgtgctt
ccgtttaacgagtgggaaaaaggtttcgaactcatgctcaacaaacaatgtggtaaagtt
gttttgaatctggattaa

DBGET integrated database retrieval system