KEGG   Fibrella sp. ES10-3-2-2: A6C57_00700Help
Entry
A6C57_00700       CDS       T04805                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fib  Fibrella sp. ES10-3-2-2
Pathway
fib00010  Glycolysis / Gluconeogenesis
fib00030  Pentose phosphate pathway
fib00051  Fructose and mannose metabolism
fib00052  Galactose metabolism
fib00680  Methane metabolism
fib01100  Metabolic pathways
fib01110  Biosynthesis of secondary metabolites
fib01120  Microbial metabolism in diverse environments
fib01130  Biosynthesis of antibiotics
fib01200  Carbon metabolism
fib01230  Biosynthesis of amino acids
fib03018  RNA degradation
Module
fib_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6C57_00700
   00030 Pentose phosphate pathway
    A6C57_00700
   00051 Fructose and mannose metabolism
    A6C57_00700
   00052 Galactose metabolism
    A6C57_00700
  09102 Energy metabolism
   00680 Methane metabolism
    A6C57_00700
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    A6C57_00700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:fib01009]
    A6C57_00700
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:fib03019]
    A6C57_00700
Enzymes [BR:fib01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     A6C57_00700
Protein phosphatases and associated proteins [BR:fib01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     A6C57_00700
Messenger RNA biogenesis [BR:fib03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     A6C57_00700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128
Motif
Other DBs
NCBI-ProteinID: ARK08945
UniProt: A0A1W6E0M2
LinkDB All DBs
Position
complement(130760..131737)
Genome map
AA seq 325 aa AA seqDB search
MKRIAVFTSGGDAPGMNACIRAVVRGAVYHGLEVFGIRRGYNGMINGDIFQMTSHSVSNI
VQRGGTILKSARSKEFMTPEGRQKAYDQLQKFGIEGLVAIGGNGTFTGATLFFDEFGIPT
VGAPGTIDNDLYGTDYTIGFDTAVNTALEAIDKIRDTADSHDRIFLIEVMGRDSGYIAIQ
SGIAGGAELVMVPEVLTPISEVVNILQQGFTRSKSSSILVVAEGEEEGSAKEVAAKISQM
MVGQDLDMRVTTLGHIQRGGVPTAYDRILASRLGLGALEGLMNGEKNVMAGVINNELVYT
PFRDTIRLPKPINEDLLRMVKILSV
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgtgtttacctccgggggtgatgcgccgggtatgaacgcctgtatc
cgggcggttgtgcgcggggccgtttaccacggtcttgaagtatttggcattcgccggggg
tataatggaatgattaatggcgacatattccagatgacttcgcactcggtgagcaatatt
gttcagcgaggtggtactattctgaagtcggctcgcagcaaggagttcatgacccccgaa
gggcggcagaaagcctatgaccagttgcaaaaatttggtatcgaagggctggtcgccatc
ggcggtaacggtacgtttaccggcgctaccctcttcttcgatgagtttggtattccaaca
gtgggggcccccggaaccattgataatgacctctacggcaccgactacaccattggcttc
gatacggcagtaaatacggccctggaagcgatcgataaaattcgcgatacggccgattca
cacgaccggatcttcctgatcgaagtaatggggcgtgactcaggttatatcgccattcag
tcgggtattgccggcggtgccgaactggtcatggtgcccgaggtactaacgccgatctct
gaagtggtgaatattctgcaacagggctttacccgcagcaaatcatcgtctatcctggtc
gtagctgaaggcgaagaagaaggcagcgcaaaagaagtggccgcaaagatcagccagatg
atggttgggcaagacctggacatgcgcgtaactacactgggccatattcagcgtgggggc
gtacccacggcctacgaccgcattctggccagccgcctgggacttggagctcttgaaggc
cttatgaatggtgaaaagaacgtaatggcaggggtgatcaacaatgaactggtctacacg
ccgttccgcgatacgattcggttgcccaaaccaattaatgaagacttactcaggatggtg
aaaatcctgtcagtatag

DBGET integrated database retrieval system