KEGG   Fibrella sp. ES10-3-2-2: A6C57_04670Help
Entry
A6C57_04670       CDS       T04805                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
fib  Fibrella sp. ES10-3-2-2
Pathway
fib00040  Pentose and glucuronate interconversions
fib00051  Fructose and mannose metabolism
fib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    A6C57_04670
   00051 Fructose and mannose metabolism
    A6C57_04670
Enzymes [BR:fib01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     A6C57_04670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C TrkA_N ThiF Sacchrp_dh_NADP ADH_zinc_N_2 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ARK09682
UniProt: A0A1W6E2Q8
LinkDB All DBs
Position
1109320..1110351
Genome map
AA seq 343 aa AA seqDB search
MKALVLTEYNHFELQDVATPKPGPTDVLIRVQAVGICGSDVHGMDGSTGRRVPPIVMGHE
ASGIIAEIGDDVRDWAVGDRVTFDSTVYKLDDWYSRRGMYNLSDGREVVGVSTPQFRRNG
AFAEFVTVPQHILYAIPEGVSFTQAALVEPVAVALHALSLTPIQVNDSAVVVGAGMIGLF
VIQALKLAGCSQIIAIDLDDDRLALAQKLGATDAFRADADNVPGQVQALTHGRGADVAFE
VVGIAPTVQTAISCVRKGATITLVGNLSPKIEIPLQAIVTQQLRLQGSCAINGEYEAALS
LISSGKIDVEAILSAEAPLTEGADWFNRLQAKEKGLIKVVLKP
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgctcgtcttaacggaatacaatcacttcgagctacaggacgtagctactccc
aaacccggccccactgacgtactgattcgggtacaggcggtgggcatttgcggctctgat
gtgcacggcatggatggcagcaccggccgccgtgttccccccattgtgatgggccacgaa
gcctccggcattattgccgagattggtgacgacgtacgcgactgggccgtgggcgaccgc
gtgacgttcgattcgaccgtgtataaactggacgactggtacagtcgccgggggatgtat
aacctctccgatggacgcgaagttgtgggggtgtcgaccccgcagtttcgccgcaacggg
gcgtttgccgagttcgtcaccgtaccgcagcacattctctacgccattcccgagggagtc
agctttacgcaggcggcgctggttgagccagtggccgtggccctgcacgcgttgagcctt
acgcccattcaggtcaatgattcagccgtggtggtgggcgcgggcatgattggcctgttc
gtgattcaggccctgaaactggccggttgcagtcagatcatcgccatcgacctcgacgat
gatcgactggctctggcgcagaaacttggtgctaccgatgccttccgcgccgacgctgat
aacgtacctggacaagtacaggccttaacccatgggcgcggtgccgatgtagcctttgaa
gtggtgggtattgcgccaactgtacaaactgccatcagctgcgtccggaagggagccacc
attacgctggttggcaacctgagtcccaagatcgagattccgttgcaggccattgtcacg
cagcaactccggctgcaaggatcgtgcgccatcaatggcgaatacgaagccgccctgagc
ttgatttcgagtggcaaaatagacgtcgaagccattttaagcgccgaagctcccttaacc
gaaggggccgactggttcaaccgcctccaggcaaaggagaaaggattaattaaagtcgta
ctgaaaccgtaa

DBGET integrated database retrieval system