KEGG   Fibrella sp. ES10-3-2-2: A6C57_21950Help
Entry
A6C57_21950       CDS       T04805                                 

Definition
(GenBank) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fib  Fibrella sp. ES10-3-2-2
Pathway
fib00052  Galactose metabolism
fib00511  Other glycan degradation
fib00600  Sphingolipid metabolism
fib01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A6C57_21950
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    A6C57_21950
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    A6C57_21950
Enzymes [BR:fib01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     A6C57_21950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3 Big_1 B_lectin fn3_5
Motif
Other DBs
NCBI-ProteinID: ARK12782
UniProt: A0A1W6EBN2
LinkDB All DBs
Position
5512943..5515702
Genome map
AA seq 919 aa AA seqDB search
MQINNSLTGFFGNLKLIGLVLLVGLTDASGQPATSSAGAGLKRERIKLSDGWRFMRYTTE
PDKLMYAVRPPVQDANDSKVADSKPTEAVRVDGKDEELKNWILPTANDFIKNPAQRHTRP
AGNPGADFAFVKAGFADTNWEAVTVPHDWAIKGPFYGGDQPEVGGGMGRLPSQGVAWYRK
KLTIPASDRGKQIYLDIDGAMSYAMVWLNGQLVGGWPYGYNSFRLDLTPYIQVGDVNQLA
IRVDNPNHSARWYPGAGLYRNVWLTKLAPVHVAQWGTFVTTPAVSATEATVNLALRIANK
ATQAQTVTVQTQLYALDASAKPTGKPLATFPTATLTLQPGESQPVTSTLNLKNPKRWGPY
PTQTPNRYVARTSLLVNGKPVDEYDTPFGIRSVVFDPTRGVLVNGEVVRIQGVNQHHDLG
ALGAAFNVRAAERQLELLRELGCNAIRMAHNPPAPELLDLTDRMGFLIIDEIFDSWERKK
TPHDFHLIFPDWHEPDTRAFVRRDRNHPSIIAWSFGNEVGEQYTDTAGAALAQKLHDIVY
EEDPTRPASASQNYAKPDMPFTKEMDFLSLNYQGEGIRDAPAYAHLKGIRTTPLYPAFQK
AYPNKVIISSETASALSTRGSYNFPVHPENSAPVSNGVGGDPTTKEVSAYELYTAAFGAS
PDKVFATQDRHPYVAGELVWTGWDYLGEPTPYYSARSSYSGIIDLAGFKKDRFYLYQSRW
RPELPMVHLLPHWNWPNRIGQVTPVHVFTSGDEAELFLNGRSLGRKKKAPYTYRLRWDEV
TYQPGELTVVAYKNGREWARQRVSTTDKPAKLVAQADRSTIKADGEDLSFITVKVTDKNG
SMIPDASHTVRFSLQGDGELVATDNGDPASLVSFASPYRQAYNGMALVIIRAKKGHRGKL
TLTATAEGLAPARIELTSN
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcaacaattcgctaaccggcttttttggcaacctgaaactcattggcttagta
ctacttgtcggcctgaccgatgcatccggtcagccagctacttcgagcgcaggggcaggc
ctcaaaagagaacgcatcaagctcagcgacggctggcgttttatgcgctataccaccgag
cccgacaaattgatgtatgcggtcaggccacccgtgcaggatgccaacgacagcaaagtg
gccgactccaaaccaaccgaagcagtcagggtagatggtaaagacgaggagctgaaaaac
tggattttgcccacagccaacgacttcatcaagaatccggcgcaacgccacacccgcccc
gccggtaaccctggcgccgactttgcctttgtgaaagccgggtttgccgacaccaactgg
gaggccgtaaccgtaccgcacgactgggccatcaagggtcccttttacgggggcgatcag
cccgaagttggcgggggtatggggcggctgcctagtcagggcgtagcgtggtatcgtaaa
aaactaacgattccagccagcgaccggggtaaacagatttacctggacattgacggggcc
atgtcgtacgcgatggtgtggctcaatggccagttggtgggaggctggccgtatgggtat
aactcgttccggctcgacctcacgccctacatccaggtcggcgacgtaaatcagctggcc
atccgggtggataaccccaaccattcggccaggtggtaccctggagcgggcctgtaccgc
aacgtctggctaacgaaactcgcccctgtgcatgtggctcagtggggtacgttcgtcacc
acccctgcggtgtcggctaccgaagccacggttaaccttgccctacgcattgcaaacaaa
gcaacacaggcgcagaccgtgaccgtacaaacacagctttacgcccttgatgcgtcggcc
aagccaaccggaaaacctctggccacatttccgaccgcgacactcaccctgcagccaggc
gaaagtcagccggtaacgagcacgctgaacctcaaaaacccgaaacgctggggcccttac
ccaacccagacacccaatcgctacgtagcccgcaccagcctcctcgtcaacgggaagccg
gtcgatgaatacgataccccattcggtatccgaagcgtagtgttcgacccaaccaggggg
gtactggtcaatggcgaagtggtacgcattcagggtgtgaaccagcaccatgatttagga
gcgctgggcgccgccttcaacgttcgggcggccgaacggcaactcgaattgctacgcgaa
ctggggtgcaatgccatccgcatggcgcataacccgcctgcccccgaactcctcgacctg
actgaccgtatgggatttctgattatcgacgagattttcgatagctgggagcgcaagaaa
acgccgcacgattttcacctgatatttcccgactggcacgagccggacacacgcgccttt
gttcgccgcgaccgcaatcacccgtccatcatcgcctggagtttcggtaatgaggtcggc
gagcaatacaccgatacggctggtgcagcgcttgcccagaagctgcacgacattgtgtat
gaagaagacccgacccggcccgcttcggcttcacagaactacgccaagcctgacatgccg
ttcacaaaagagatggatttcctgagcctcaactaccagggcgaaggcatcagggacgca
cccgcctacgcgcatttgaaggggattcgcaccacgccgctctaccccgcttttcagaaa
gcgtaccccaataaagtgatcatcagcagcgaaacggcctcggccttaagcacacgcggg
tcctataattttccggtccatcccgaaaactcggctccagtaagcaacggcgtcgggggc
gacccaaccaccaaagaagtaagcgcctacgaactatacacggccgcttttggcgcatcg
cccgataaagtgtttgccacgcaggaccgccatccgtacgtagcgggtgaactcgtctgg
acgggctgggactatctgggtgagcctactccctactattcggcccggagttcatactcc
ggcataattgacctggcaggtttcaaaaaagaccggttctacctctatcagtcgcggtgg
cggcctgaactgcctatggtgcacttgctgcctcactggaactggcctaaccggattggt
caggttacccccgtccacgtatttacgtcgggcgacgaagctgagcttttcctgaatggc
cggtcgctgggccgcaaaaagaaagcgccctatacctatcgtctccggtgggacgaggtg
acgtatcagcccggcgaactgaccgtggtggcctacaaaaatggccgcgaatgggcccgg
caacgcgtgagcactaccgataaacccgccaaactggtggcgcaggcagatcgatctacg
atcaaggccgatggcgaggacctttcgttcattacggtgaaggtgaccgacaaaaacggg
tcgatgattccggatgccagccatacggtgcgcttcagcctgcagggcgacggcgaactt
gtggcaaccgacaatggggatccggccagtctggtttcgtttgcgtcgccctatcggcag
gcctacaacggcatggcgctggtgattatccgggccaagaaaggccaccggggtaagctg
accctgaccgccaccgcagaagggcttgcccccgcccgaattgagttaacaagcaactaa

DBGET integrated database retrieval system