KEGG   Fibrella sp. ES10-3-2-2: A6C57_25625Help
Entry
A6C57_25625       CDS       T04805                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
fib  Fibrella sp. ES10-3-2-2
Pathway
fib00010  Glycolysis / Gluconeogenesis
fib00052  Galactose metabolism
fib01100  Metabolic pathways
fib01110  Biosynthesis of secondary metabolites
fib01120  Microbial metabolism in diverse environments
fib01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A6C57_25625
   00052 Galactose metabolism
    A6C57_25625
Enzymes [BR:fib01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A6C57_25625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ARK13446
UniProt: A0A1W6EDP1
LinkDB All DBs
Position
6398108..6399232
Genome map
AA seq 374 aa AA seqDB search
MKKLAPLLFFAGSILLYSFLVPKAGIVKSVFGQLPDGREVNLFTLRNAKGMEVAITNYGG
YLVSLTAPDKQGKAENVVLGLGTLADYLKGNPNLGPIIGRYGNRIAQGKFTLDGTDYKLF
TNQAGIHIHGGRVGFDKKLWTATPIDGAEPALKLQYTSPDGEESYPGTLNVEVTYTLQKD
NALRIDYKATTDKATVVNLTNHAYFNLSGMKTDVMNNVVQLKADKYLPTDRTQIPTGEIK
PVAGTPFDFTRPIPISAHINDTTDTQIRYGRGYDHCWVFTDQSTKLKLGATVYEPTSGRL
MEVYTTEPGVQLYTANHLNGLVKSPQGIPYTRRFALCLETQHFPDSPNHPNFPTTTLRPG
ATYLSSTVYKFKVR
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactcgctccactcctcttttttgccggtagtatcctgctttactccttcctg
gtccccaaagcaggcattgttaaatcggtgttcgggcagctgcccgacggccgcgaggtg
aacctgtttacactgcgcaatgcaaagggaatggaagtagctatcaccaactatggcggc
tacctggtgtcgcttactgcacccgataagcaggggaaagccgaaaacgtagtgctgggg
ctgggtacgttggccgactacctgaaaggcaaccctaacctcgggcccattattggccgc
tatggaaaccggatcgcacagggcaaattcaccctcgacggcaccgactacaagctgttt
accaatcaggcgggcattcatattcacggcggaagggttggcttcgacaaaaagctgtgg
acggctacccccatcgacggtgccgaaccggcacttaaattacagtacacctcacccgac
ggcgaagagagctacccgggtacgctgaacgttgaggtgacctacacgctccagaaagac
aacgccctgcggatcgattacaaggccacgaccgacaaagccacggtggtcaacctgacc
aatcacgcttatttcaacctgagcggtatgaaaaccgacgtgatgaacaacgtggtgcaa
ctcaaagccgacaagtatctgccgaccgacaggacgcaaataccaacgggcgagatcaag
cccgtggccggaacacccttcgattttaccaggcccatccccatcagcgcgcacatcaac
gacacgacggatacgcaaattcgctacggacgaggctacgaccattgttgggtatttacc
gaccagtcgacgaaactaaagctgggtgccaccgtgtacgaacctactagcggccgactg
atggaggtgtataccactgaaccgggcgtacaactctacaccgccaaccacctgaacgga
ctggtgaaaagtccgcagggtattccctacacccgccgctttgcgctctgcctggaaact
cagcacttccccgactcgcccaatcaccccaatttcccgaccacaacccttcggccgggc
gcaacgtacctgagcagtacggtctacaagttcaaggtgcgctaa

DBGET integrated database retrieval system