KEGG   Flavobacterium indicum: KQS_01255Help
Entry
KQS_01255         CDS       T01781                                 

Gene name
tdk
Definition
(GenBank) Thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
fin  Flavobacterium indicum
Pathway
fin00240  Pyrimidine metabolism
fin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    KQS_01255 (tdk)
Enzymes [BR:fin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     KQS_01255 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: CCG52246
UniProt: H8XNX9
LinkDB All DBs
Position
complement(282487..283080)
Genome map
AA seq 197 aa AA seqDB search
MFLENTVNQEEQFGWIEVICGSMFSGKTEELIRRLKRAQFAKQKVEIFKPAIDTRYHEEM
VVSHNKNEIRSTPVPAAENIRILAQGCDVIGIDEAQFFDDEIVAVCNDLANSGIRVIVAG
LDMDFKGNPFGPMPALMATAEYVTKVHAVCTRTGNLAHFSYRKATSENLVLLGETDEYEP
LSRAAYYKAMRESKEEE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtttctcgaaaataccgtaaatcaagaagaacaatttggctggattgaagtaatctgc
ggctctatgttttctggcaaaacagaagaattaattcgtcgattaaaaagagcccaattt
gccaaacagaaagttgaaattttcaaacctgcaattgacacgcgctaccatgaagaaatg
gtggtttcacacaacaaaaatgaaattcgttctactccagtaccagcagcagaaaacatt
agaattttagctcaaggttgcgacgtaataggtattgatgaggcccaattttttgacgat
gaaattgtagctgtttgcaatgatttagcgaatagtggaatacgtgtaattgtagccgga
ttagacatggattttaaaggcaatccattcggtcctatgcctgcattaatggctactgca
gaatacgttactaaagtacatgccgtttgtacaagaacaggtaatttagcccattttagt
tatagaaaagccacaagtgaaaacctagttttattaggtgaaacagacgaatacgaacct
ttaagtagagctgcttattataaggctatgcgagaaagtaaagaagaagaataa

DBGET integrated database retrieval system