KEGG   Flavobacterium indicum: KQS_11875Help
Entry
KQS_11875         CDS       T01781                                 

Definition
(GenBank) Fatty acid desaturase
  KO
K00508  linoleoyl-CoA desaturase [EC:1.14.19.3]
Organism
fin  Flavobacterium indicum
Pathway
fin01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fin00001]
 09100 Metabolism
  09103 Lipid metabolism
   00591 Linoleic acid metabolism
    KQS_11875
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:fin01004]
    KQS_11875
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     KQS_11875
Lipid biosynthesis proteins [BR:fin01004]
 Desaturase
  Front-end
   KQS_11875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Na_H_antiporter ABC2_membrane DUF2207
Motif
Other DBs
NCBI-ProteinID: CCG54286
UniProt: H8XR52
LinkDB All DBs
Position
2532709..2533803
Genome map
AA seq 364 aa AA seqDB search
MSTQAPIFAKIDKSQFFRTLNKRVNEYFKENNIKKTGNWQLHLKTIVMFTLFLAPYFFLL
TVDMPFWLYILLNVVIGIGMAGVGMNVMHDGNHGAYSDKSWLNKIMGSSIYILAGNVYNW
QVQHNVLHHTYTNILGHDEDLEAGRILRFSQTSKWYKHHKFQHLYSIFLYGLLTFNWAIT
TDFLQMKRYLKRKLSYGEFKSPTFQWTTLAITKALYFSIWIVIPIVLGITWWKVLLGFVV
MHYTAGLILSVVFQLAHVVENTVNPEPNENGEMENTWAVHQLFTTANFAPKNWLINWYTG
GLNHQIEHHIFPNISHIHYGKIGEIVKQTAKECNLPYYEFKTTRAAIASHFKHLKELGKK
PQLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactcaagctccaatttttgctaaaattgataaatcacagtttttcagaacgtta
aataaacgcgtaaacgaatatttcaaagaaaacaacattaagaaaacaggaaattggcaa
ttacatttaaaaacaattgttatgtttactttgtttttagctccttattttttcctatta
accgtagacatgcccttttggttatacattctattaaatgtagttattggaattggaatg
gccggcgttggaatgaatgtaatgcacgatggaaatcacggtgcttattccgataaatca
tggttgaataaaatcatgggaagtagcatttatatcttagctggaaatgtgtacaattgg
caagttcaacacaatgttttacaccatacttatactaatattttaggacatgatgaagat
ttagaagccggaagaattttgcgtttttctcaaacctctaaatggtacaaacaccataaa
tttcaacatttatactctattttcttgtatggattattaacgttcaactgggcaatcact
actgatttcttgcagatgaaacgctacttaaaaagaaaattatcatatggcgaatttaaa
agtccaaccttccaatggactactttagccattactaaagccttatatttttctatttgg
attgtaatccctattgttttaggtattacttggtggaaagttttattaggttttgtagtg
atgcattacacagcaggattaatattaagtgtggtattccaattagcacacgtggttgaa
aacacggtgaaccccgaacccaatgaaaacggagaaatggaaaacacttgggctgttcat
caattatttactacagctaattttgctccaaaaaactggttaattaattggtacactggc
ggattaaaccaccaaatagaacatcatattttccctaacattagccatattcattatgga
aaaattggagaaattgttaaacaaactgcaaaagaatgtaatttaccttattacgaattt
aaaacaacaagagccgcaattgcttctcactttaaacacttaaaagaattaggtaaaaaa
ccacaattagcataa

DBGET integrated database retrieval system