KEGG   Flavobacterium indicum: KQS_12970Help
Entry
KQS_12970         CDS       T01781                                 

Gene name
pcd
Definition
(GenBank) Piperideine-6-carboxylate dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fin  Flavobacterium indicum
Pathway
fin00010  Glycolysis / Gluconeogenesis
fin00053  Ascorbate and aldarate metabolism
fin00071  Fatty acid degradation
fin00280  Valine, leucine and isoleucine degradation
fin00310  Lysine degradation
fin00330  Arginine and proline metabolism
fin00340  Histidine metabolism
fin00380  Tryptophan metabolism
fin00410  beta-Alanine metabolism
fin00561  Glycerolipid metabolism
fin00620  Pyruvate metabolism
fin00625  Chloroalkane and chloroalkene degradation
fin01100  Metabolic pathways
fin01110  Biosynthesis of secondary metabolites
fin01120  Microbial metabolism in diverse environments
fin01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KQS_12970 (pcd)
   00053 Ascorbate and aldarate metabolism
    KQS_12970 (pcd)
   00620 Pyruvate metabolism
    KQS_12970 (pcd)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KQS_12970 (pcd)
   00561 Glycerolipid metabolism
    KQS_12970 (pcd)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KQS_12970 (pcd)
   00310 Lysine degradation
    KQS_12970 (pcd)
   00330 Arginine and proline metabolism
    KQS_12970 (pcd)
   00340 Histidine metabolism
    KQS_12970 (pcd)
   00380 Tryptophan metabolism
    KQS_12970 (pcd)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KQS_12970 (pcd)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KQS_12970 (pcd)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KQS_12970 (pcd)
Enzymes [BR:fin01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     KQS_12970 (pcd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: CCG54496
UniProt: H8XRR2
LinkDB All DBs
Position
2758152..2759705
Genome map
AA seq 517 aa AA seqDB search
MSTIAQQFGIAEALKQLGVKDINPGSSTGSNWFANGEIIESYSPVDGQLIGKVQATTAAD
YEKVMAAATEAFKEFRTMPAPKRGEIVRQFGNKLRELKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQVIPSERPGHVMREQWHPIGVVGIISAFNFPVAVWSWNTAL
AWICGDVCVWKASEKAPLCSIACQNIIADILKENGLPEGISCIVNGDYKVGEMITTDTRI
PLVSATGSTRMGRIVGAKVAERFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCG
QRCTSTRRLIIHESVYDTVRDAIVGAYGQIKIGNPLDEKNHVGPLIDTDAVNTYLAAIEK
AKAEGGNVLVEGGVLTGEGFESGCYVKPAIIEAENHFEIVQHETFAPILYLMKYSGEVEN
AIELQNGVAQGLSSSIMTNSMKEAEKFLSYAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDQLPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaatagctcaacaattcggtattgctgaagcgcttaaacaattaggcgtaaaa
gatattaatccaggttcttcaacaggttcaaattggtttgccaatggcgaaattattgaa
tcgtattcaccagtagacggacaattaattggtaaagttcaagctactacagcagcagat
tatgaaaaagtaatggcagcagctacagaagcttttaaagaattcagaactatgcctgct
ccaaaaagaggagaaatcgttcgtcaattcggaaataaattaagagaattaaaagaaccg
ctaggaaaattagtttcttatgaaatgggtaaatcgttacaagaaggctatggtgaagtt
caggaaatgatcgacatctgtgactttgctgttggtttatcgcgtcaattaaacggacaa
gttattccttctgaaagacctggtcacgtaatgcgtgagcaatggcatccaattggagta
gtaggaattatttctgctttcaatttccccgttgcagtttggtcttggaacacggcttta
gcttggatttgtggtgatgtatgtgtatggaaagcttctgaaaaagcacctttgtgctct
attgcttgtcaaaatataattgctgatatcttaaaagaaaacggattacctgaaggtatc
tcttgtattgtaaatggagattataaagtaggtgaaatgattactactgacactcgtatt
cctttagtttctgctacaggttccactcgtatgggaagaattgtaggtgcaaaagttgca
gagcgttttggtaaatcattattagaattaggtggtaacaacgctattattattacgcct
actgccgacttaaaagtggtggttcctggtgctgtatttggcgctgtgggtacttgtgga
caacgttgtacatctactcgaagattaattattcatgaatcagtttatgatacggttcgc
gatgcaattgtgggtgcgtatggacaaatcaaaattggtaatccattagacgagaaaaac
catgtaggtccattaatcgatacggatgcggttaacacgtatttagctgccattgaaaaa
gcaaaagctgaaggtggtaacgttttagtagagggcggtgtattgacaggagaaggtttt
gaaagtggttgttacgtaaaaccggctatcattgaggctgaaaatcattttgaaattgtt
caacacgaaactttcgctcctattttatacttaatgaaatacagcggagaagttgaaaat
gcaattgaattacaaaatggtgtagcgcaaggtttatcatcatctattatgaccaacagc
atgaaagaagctgaaaaattcttatcatatgcaggttctgactgcggtattgctaatgta
aatatcgggacttctggtgcagaaattggtggtgcttttggtggtgaaaaagaaactggt
ggtggtcgtgaatcaggttctgatgcatggaaagtgtacatgagaagacaaaccaacacg
gttaactactcagatcaattacctttagcacaaggaattaaatttgatttgtag

DBGET integrated database retrieval system