KEGG   Fischerella sp. NIES-3754: FIS3754_04950Help
Entry
FIS3754_04950     CDS       T04195                                 

Definition
(GenBank) manganese and iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
fis  Fischerella sp. NIES-3754
Brite
Enzymes [BR:fis01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     FIS3754_04950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N LemA FAP
Motif
Other DBs
NCBI-ProteinID: BAU04607
UniProt: A0A0S3THR1
LinkDB All DBs
Position
complement(534969..535730)
Genome map
AA seq 253 aa AA seqDB search
MIFQRRHFLVLLGAGVGAFALDACASANTPTPSPPTTPIPIPTPTPPSSSGAIQLPPLPY
DYNALEPHIDEATMRFHHDKHHATYVKNLNAALDKYPALKNKNVEDLLRNLNSVPEDIRT
TVRNNGGGHINHSMFWLIMKPDGGGEPTGAIANAIQDNFGSFANFKKQFNDAGSKLFGSG
WVWLVRNPDGKLEVVTTPNQDTPLSEGKYPIIGNDVWEHAYYLKYQNRRADYLDAWWNVL
NWDEINKRFAAAT
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcaacgtcgacactttttggttctacttggtgcaggtgtaggtgcttttgct
ttagatgcttgtgcttccgccaatacaccgactcccagccctcctactactcctattcct
attcctactcctactcccccaagtagttcaggagcaattcaactaccacctttaccttat
gattacaatgccctagaaccacacattgatgaagctacaatgcgcttccatcatgacaaa
caccatgcaacttatgtcaaaaatctgaatgctgcattggataaatatccagctctcaaa
aacaaaaatgtagaagatttactgcgtaatctcaacagcgtccctgaagatattcgcaca
acggtacgcaataatggtggtggtcatattaaccactcgatgttttggctgattatgaaa
ccagatggtggtggtgaaccaactggagcgatcgctaacgctatccaagacaattttggc
agttttgcaaatttcaaaaagcagtttaacgatgctgggagtaaactttttggtagtggt
tgggtttggcttgtgcgtaacccagatggcaagcttgaggttgtcactacacccaatcag
gacactcccctgagtgaaggcaaatatccaataatcggtaatgatgtatgggaacatgct
tattacctcaaataccaaaaccgccgcgccgattatttagacgcttggtggaatgtgctg
aactgggatgaaataaacaaacgattcgcagcagcaacttaa

DBGET integrated database retrieval system