KEGG   Fischerella sp. NIES-3754: FIS3754_13750Help
Entry
FIS3754_13750     CDS       T04195                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00010  Glycolysis / Gluconeogenesis
fis00053  Ascorbate and aldarate metabolism
fis00071  Fatty acid degradation
fis00280  Valine, leucine and isoleucine degradation
fis00310  Lysine degradation
fis00330  Arginine and proline metabolism
fis00340  Histidine metabolism
fis00380  Tryptophan metabolism
fis00410  beta-Alanine metabolism
fis00561  Glycerolipid metabolism
fis00620  Pyruvate metabolism
fis00625  Chloroalkane and chloroalkene degradation
fis01100  Metabolic pathways
fis01110  Biosynthesis of secondary metabolites
fis01120  Microbial metabolism in diverse environments
fis01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fis00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIS3754_13750
   00053 Ascorbate and aldarate metabolism
    FIS3754_13750
   00620 Pyruvate metabolism
    FIS3754_13750
  Lipid metabolism
   00071 Fatty acid degradation
    FIS3754_13750
   00561 Glycerolipid metabolism
    FIS3754_13750
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FIS3754_13750
   00310 Lysine degradation
    FIS3754_13750
   00330 Arginine and proline metabolism
    FIS3754_13750
   00340 Histidine metabolism
    FIS3754_13750
   00380 Tryptophan metabolism
    FIS3754_13750
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FIS3754_13750
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    FIS3754_13750
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FIS3754_13750
Enzymes [BR:fis01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     FIS3754_13750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: BAU05479
UniProt: A0A0S3TK60
LinkDB All DBs
Position
complement(1500727..1502112)
Genome map
AA seq 461 aa AA seqDB search
MISETSIHEILDQQRVFFQSGKTQSLSFRILQLKLLQQSVKENETVICQALKADLNKPEF
EAFSSEIILVIKEIEYCIKNLKKWTKPQKAKVPWQLLPASAKIYPEPLGVVLIIGSWNYP
FQLVITPLIGAIAAGNCTIIKPSELAPHTSSVISKLIAKYFQPEYITVIEGGVETSQKLL
SEKFDHIFFTGGTAVAKIIMEAAAKNLTPVTLELGGKNPCIVDTDIHITHTARRITWGKF
INAGQTCLAPDYLLVHTNIKKNLISAIQKCIQDFYGNNPAISPDYGRIINQKQFDRIISL
LKGNKIIFGGETNREQLYIAPTLIENASLTDSIMQEEIFGPVLPIIEYTDISEAIALINS
LPKALALYLFSNNKNLQQRVLQTTSSGTVCLNETVMHIGVSSLPFGGVGDSGIGSYHGKF
SFDTFSHYKSVLHNPFWLDLKWRYAPYTKGKLSFLKRLIGY
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatttctgaaacgtcaattcatgaaattcttgatcaacaacgagttttttttcaatct
ggtaaaactcaatcactatcttttcgtattttgcaactcaaacttttacaacaaagcgtt
aaggaaaacgaaacagtaatttgtcaggctttaaaagcagatttaaataaaccagaattt
gaggctttttcttcagaaataatattagttatcaaagaaattgaatattgtatcaaaaat
cttaaaaaatggactaagcctcaaaaagcaaaagtcccttggcaattacttcctgcttca
gcaaaaatttatccagaaccgttaggagttgttttaattattggtagttggaattatcct
tttcagttagtaatcacaccattgatcggagcgatcgctgctggaaattgtactattatt
aaaccatcagaattagctccgcatacatccagtgttatttctaagctcatagctaaatat
ttccagccagaatacattacagttattgaaggaggtgtggaaacaagtcaaaaattattg
tcagaaaagtttgatcacatatttttcactggcggtactgctgtagctaaaattattatg
gaagccgcagccaaaaatcttacacctgtgaccttagaattgggtggcaaaaatccttgt
attgttgatacagatattcatattacacatactgctagacgcattacttggggtaagttt
attaatgctggacaaacttgcttggcaccagattatttattagtacatactaacattaaa
aaaaatttaatatctgcaattcaaaaatgtatccaagacttttatggcaataaccctgcc
atcagtcctgattatggcagaattatcaatcaaaaacaatttgatagaatcataagtctt
ttaaagggaaataaaattatttttggtggagagacaaacagagaacaactttatattgct
cctacattaatagagaatgcttccttgacagattctattatgcaagaggaaatttttggg
ccagttttaccaattatcgaatacacagatatatcagaagcgatcgctttgatcaattcc
ctacctaaagctttagctttatacttattttctaataataaaaatcttcaacaaagagtt
ttacagacaacttcatcagggactgtgtgtctcaatgaaacagtcatgcatattggagtc
tcatccttaccatttggtggcgtaggtgatagcggtatcggcagttatcacggtaaattt
agttttgacacattttctcactataaaagtgtattacacaatcccttttggttggattta
aaatggcgatatgctccctacacaaagggtaaattatcttttttaaaaagattgattgga
tactag

DBGET integrated database retrieval system