KEGG   Fischerella sp. NIES-3754: FIS3754_23110Help
Entry
FIS3754_23110     CDS       T04195                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00040  Pentose and glucuronate interconversions
fis00051  Fructose and mannose metabolism
fis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    FIS3754_23110
   00051 Fructose and mannose metabolism
    FIS3754_23110
Enzymes [BR:fis01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     FIS3754_23110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C 2-Hacid_dh_C Cas_csx3 ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: BAU06398
UniProt: A0A0S3TMR6
LinkDB All DBs
Position
2651329..2652375
Genome map
AA seq 348 aa AA seqDB search
MKAQVFRGVNQLSYEEIPVPELQPDEVLVQVRVVGLCQSDIKKIRYPLYEPPRIFGHETA
GTIAAVGAEVKNWQVGQRVAVMHHIPCMRCDYCLNDNFSMCDTYKNICTTAGFTPSGGGF
AEYVKVPGHIVRNGGLIPIPDNISFEEASFVEPTNCCLKAVKKAQIAPGQTVLITGAGPI
GLMFVMLVKYFGAKAIATDLIPSRIEKALVVGAEAAFDARDADLPAKIQALTNGLGVDVT
LLAVPSEKAFFQALDCTRKGGKILFFAEFPDEVEIPLNPNILYRREIDLMGSYSSSYRLQ
SLSADIVFNKRIDVQALISDRYPLQNLSQAVDQAITPTPETYKILIYP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcacaggtatttagaggcgttaatcaactttcctacgaagagatccctgtaccc
gaattgcaaccggatgaggtgttggtacaggtgcgggtagtaggtttgtgtcagtcggat
atcaaaaaaattcgttatcccctgtatgagccaccacgcatttttggacatgaaactgcg
ggaacgatcgcagcagtaggtgcagaggtgaaaaattggcaagtcggacaacgggtggcg
gtgatgcaccacatcccttgtatgcgttgtgattattgtctgaatgacaatttttcaatg
tgtgacacgtataaaaatatctgcacgacagccggatttacacccagtggtggcggcttt
gctgagtatgtcaaggttcctggtcacattgtccgcaatggtgggttgattcccatcccc
gataatatcagttttgaagaagcaagctttgttgaacctactaactgctgtctcaaagca
gtgaaaaaagcccaaattgctcccggacaaacagttttgattactggtgcggggccgatt
gggttaatgtttgtgatgttggtaaaatattttggggcaaaagcgatcgctactgatctc
attccctcccgcatcgaaaaagctttggttgtgggtgcagaagcagcttttgacgcccgc
gacgctgatttaccagctaaaattcaagcactcactaatggtttaggtgtggatgtcacc
ttgcttgctgttcccagtgaaaaagctttcttccaagcccttgactgtacccgcaaaggc
ggtaagattctctttttcgccgaatttcccgatgaagtggaaattcctctgaatcccaat
attctctatcgtcgagaaatagatttgatgggtagctacagttcatcctaccgcctgcaa
agcctctcggccgatattgtgtttaacaaacgcattgatgtacaggcattaatcagcgat
cgctacccattacaaaatttatctcaagccgtagaccaagcgatcacaccaacaccggaa
acatataagattttgatttatccctaa

DBGET integrated database retrieval system