KEGG   Fischerella sp. NIES-3754: FIS3754_38240
Entry
FIS3754_38240     CDS       T04195                                 

Definition
(GenBank) dehydrogenase catalytic domain-containing protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00010  Glycolysis / Gluconeogenesis
fis00020  Citrate cycle (TCA cycle)
fis00620  Pyruvate metabolism
fis01100  Metabolic pathways
fis01110  Biosynthesis of secondary metabolites
fis01120  Microbial metabolism in diverse environments
fis01200  Carbon metabolism
Module
fis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIS3754_38240
   00020 Citrate cycle (TCA cycle)
    FIS3754_38240
   00620 Pyruvate metabolism
    FIS3754_38240
Enzymes [BR:fis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FIS3754_38240
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Other DBs
NCBI-ProteinID: BAU07884
UniProt: A0A0S3TS40
LinkDB
Position
4435783..4437066
AA seq 427 aa
MSIYEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
IVQAGETAPVGAAIALLAETEAEIETAKSQAQGAGTAKQETTATAAPTKTADTAASEKPA
LATHNGSNHRSGRVVASPRARKLAKELKVDLSNISGSGPYGRIVAEDVQAVIGKTSQPPA
SAAPITPAPVVTPVATTPAVAAVPGQVVPLNTLQSAVARNMVASLSVPVIHVGYTITTDA
LDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLINANYSDQGIVYPASINVAVAVAMDDGG
LITPVLQNADQLDIYSLSRTWKSLVERARVKKLQPEEYSTGTFTLSNLGMFGVDRFDAIL
PPGQGSILAIGASRPQVVATADGMFGIKQQMQVNMTSDHRIIYGAHAAAFLQDLAKLIET
NPQSLTM
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcatttacgaagtattcatgcccgcacttagttccactatgactgaaggaaaaatt
gtctcctgggaaaaatcacctggggataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttttatgaaggatatctggctcatatt
attgtgcaagctggtgaaaccgcaccagtgggagctgcgatcgccctcttggcagaaact
gaagccgaaattgaaacagccaagtctcaagcccaaggcgctggcactgcaaaacaggaa
actactgctactgctgctcccacaaaaaccgcagacacagctgcgtccgaaaagcctgcc
ttggcgactcacaacggctctaaccaccgctctggaagggttgtagcttcaccccgcgcc
cgcaaattagctaaagaactcaaagtggatttgagtaacatctctggtagtggtccttac
ggtcgtattgttgccgaagatgtgcaagccgtgatcggcaaaaccagccagccacctgct
agcgctgctcctattaccccagcaccagtggttactccggttgcaaccacaccagcagtt
gccgcagttcccggtcaagtagtgcctttgaataccttacaaagtgctgtggcacggaat
atggtcgctagcttatcagtgcctgtgatccatgtaggttacacaatcaccactgatgcg
ttggacaaattatataaacaaattaaatctaagggtgtgacaatgaccgccctcctagcc
aaagccgtagcggtgacactgcaaaaacatccattgattaacgccaattactcagatcaa
ggcattgtttatcctgctagcatcaacgtagctgtagcagtagctatggatgatggtgga
ttaattacaccagtgttgcaaaacgccgatcagctggatatctattctttatctcggact
tggaagtctttggtagaaagggcaagagttaaaaagctgcaaccagaagaatacagcacc
ggtacatttacattgtctaacttaggcatgtttggcgtcgatagatttgatgcaatctta
ccacccggacagggttcaatattagcgatcggtgcatcccgcccccaagtcgttgctaca
gctgatggcatgtttggcatcaagcaacaaatgcaggtcaacatgaccagcgatcaccgg
attatctatggcgctcatgctgcggcgttcttgcaagatttggcgaagttgattgagact
aatccgcaatctttgactatgtaa

DBGET integrated database retrieval system