KEGG   Fischerella sp. NIES-3754: FIS3754_38240Help
Entry
FIS3754_38240     CDS       T04195                                 

Definition
(GenBank) dehydrogenase catalytic domain-containing protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00010  Glycolysis / Gluconeogenesis
fis00020  Citrate cycle (TCA cycle)
fis00620  Pyruvate metabolism
fis01100  Metabolic pathways
fis01110  Biosynthesis of secondary metabolites
fis01120  Microbial metabolism in diverse environments
fis01130  Biosynthesis of antibiotics
fis01200  Carbon metabolism
Module
fis_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    FIS3754_38240
   00020 Citrate cycle (TCA cycle)
    FIS3754_38240
   00620 Pyruvate metabolism
    FIS3754_38240
Enzymes [BR:fis01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     FIS3754_38240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding PASTA
Motif
Other DBs
NCBI-ProteinID: BAU07884
UniProt: A0A0S3TS40
LinkDB All DBs
Position
4435783..4437066
Genome map
AA seq 427 aa AA seqDB search
MSIYEVFMPALSSTMTEGKIVSWEKSPGDKVEKGETVVVVESDKADMDVESFYEGYLAHI
IVQAGETAPVGAAIALLAETEAEIETAKSQAQGAGTAKQETTATAAPTKTADTAASEKPA
LATHNGSNHRSGRVVASPRARKLAKELKVDLSNISGSGPYGRIVAEDVQAVIGKTSQPPA
SAAPITPAPVVTPVATTPAVAAVPGQVVPLNTLQSAVARNMVASLSVPVIHVGYTITTDA
LDKLYKQIKSKGVTMTALLAKAVAVTLQKHPLINANYSDQGIVYPASINVAVAVAMDDGG
LITPVLQNADQLDIYSLSRTWKSLVERARVKKLQPEEYSTGTFTLSNLGMFGVDRFDAIL
PPGQGSILAIGASRPQVVATADGMFGIKQQMQVNMTSDHRIIYGAHAAAFLQDLAKLIET
NPQSLTM
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttacgaagtattcatgcccgcacttagttccactatgactgaaggaaaaatt
gtctcctgggaaaaatcacctggggataaagtggaaaaaggcgaaacagtggtggttgtc
gagtcagataaggcagatatggatgtggaatccttttatgaaggatatctggctcatatt
attgtgcaagctggtgaaaccgcaccagtgggagctgcgatcgccctcttggcagaaact
gaagccgaaattgaaacagccaagtctcaagcccaaggcgctggcactgcaaaacaggaa
actactgctactgctgctcccacaaaaaccgcagacacagctgcgtccgaaaagcctgcc
ttggcgactcacaacggctctaaccaccgctctggaagggttgtagcttcaccccgcgcc
cgcaaattagctaaagaactcaaagtggatttgagtaacatctctggtagtggtccttac
ggtcgtattgttgccgaagatgtgcaagccgtgatcggcaaaaccagccagccacctgct
agcgctgctcctattaccccagcaccagtggttactccggttgcaaccacaccagcagtt
gccgcagttcccggtcaagtagtgcctttgaataccttacaaagtgctgtggcacggaat
atggtcgctagcttatcagtgcctgtgatccatgtaggttacacaatcaccactgatgcg
ttggacaaattatataaacaaattaaatctaagggtgtgacaatgaccgccctcctagcc
aaagccgtagcggtgacactgcaaaaacatccattgattaacgccaattactcagatcaa
ggcattgtttatcctgctagcatcaacgtagctgtagcagtagctatggatgatggtgga
ttaattacaccagtgttgcaaaacgccgatcagctggatatctattctttatctcggact
tggaagtctttggtagaaagggcaagagttaaaaagctgcaaccagaagaatacagcacc
ggtacatttacattgtctaacttaggcatgtttggcgtcgatagatttgatgcaatctta
ccacccggacagggttcaatattagcgatcggtgcatcccgcccccaagtcgttgctaca
gctgatggcatgtttggcatcaagcaacaaatgcaggtcaacatgaccagcgatcaccgg
attatctatggcgctcatgctgcggcgttcttgcaagatttggcgaagttgattgagact
aatccgcaatctttgactatgtaa

DBGET integrated database retrieval system