KEGG   Fischerella sp. NIES-3754: FIS3754_41300Help
Entry
FIS3754_41300     CDS       T04195                                 

Definition
(GenBank) ribulose-bisphosphate carboxylase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00630  Glyoxylate and dicarboxylate metabolism
fis00710  Carbon fixation in photosynthetic organisms
fis01100  Metabolic pathways
fis01120  Microbial metabolism in diverse environments
fis01200  Carbon metabolism
Module
fis_M00165  Reductive pentose phosphate cycle (Calvin cycle)
fis_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
fis_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    FIS3754_41300
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    FIS3754_41300
Enzymes [BR:fis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     FIS3754_41300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAU08188
UniProt: A0A0S3TT03
LinkDB All DBs
Position
4758600..4760030
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQTKAGYQAGVKDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAGAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVPGEDNQYICYVAYPLDLFEEGSVTNMLTS
IVGNVFGFKALRALRLEDLRIPVAYLKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFMRWRDRFLFVAEAIHKAQAETGEIKGHY
LNVTAPTCEEMLKRAEFAKELKMPIIMHDYLTAGFTANTTLAKWCRDNGLLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGERGITMGFVDLLRENYVEQDKS
RGIYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACIQARNEGRNLAREGNDVIREAAKWSPELAAACELWKEIKFEFEAVDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgctcaaacgaagactcagactaaagcagggtatcaagctggggtaaaagat
tacagactaacttattacacccctgattacacaccaaaagacacggatatcttagcagca
ttccgtgttacaccccagccaggggttccacccgaagaagctggcgctgctgtggcggct
gagtcttccactggtacttggacaaccgtgtggacggacttgctgaccgacctagaccgc
tacaaaggtcgttgctatgatatcgaaccagttccaggcgaagacaatcagtatatttgt
tacgtagcctatcccctggatctgtttgaagaaggttctgtaaccaatatgttgacctca
attgtaggtaacgtatttggtttcaaagctctacgggcactgcgtctggaagacctgcgg
attccagttgcttacctcaagactttccaagggcctccccacggtatccaagttgagcgt
gacaaattaaacaaatacggtcgtcctttgttgggttgcaccattaagcccaaactcggt
ttgtctgcgaagaactacggacgcgctgtatacgagtgcttgcgcggtggtttggacttc
accaaagacgacgaaaatattaactcccagccctttatgcggtggcgcgatcgcttcttg
ttcgttgcagaagcaattcacaaagcccaagcagaaacaggtgaaatcaaaggtcactac
ctaaacgttactgctcccacctgcgaagaaatgctgaagcgggctgagttcgcaaaagaa
ctcaagatgcccatcatcatgcacgactacttaaccgcaggtttcaccgccaacactact
ttggctaagtggtgtcgtgacaacggtctattgctccacattcaccgggcgatgcacgct
gtaattgaccgtcaaaagaatcacggtatccacttccgtgttttagctaagtgcttgcgg
atgtctggtggtgatcatattcacactggtacggtggtcggtaagctggagggtgagcgc
ggtattaccatgggctttgttgacctgctgcgcgaaaactatgttgagcaagacaagtct
cgtggtatatacttcacccaagattgggcttctatgcctggtgtcatggcagttgcttct
ggtggtattcacgtatggcacatgccagcattggtggaaatctttggtgatgactcggta
ctgcaattcggtggtggtactcttggtcacccctggggtaacgctcctggtgcaaccgct
aaccgtgtggctttggaagcttgtattcaagctcgtaacgaaggtcgcaacttggctcgc
gaaggtaacgacgttatccgtgaagctgctaagtggtctcctgagttggctgctgcttgt
gaactgtggaaggaaatcaagttcgagttcgaggcagttgatacagtctga

DBGET integrated database retrieval system