KEGG   Fischerella sp. NIES-3754: FIS3754_43910Help
Entry
FIS3754_43910     CDS       T04195                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00500  Starch and sucrose metabolism
fis01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    FIS3754_43910
Enzymes [BR:fis01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     FIS3754_43910
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     FIS3754_43910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap Cellulase DUF4999
Motif
Other DBs
NCBI-ProteinID: BAU08445
UniProt: A0A0S3TTT5
LinkDB All DBs
Position
5035303..5037624
Genome map
AA seq 773 aa AA seqDB search
MQNPILKDDPLWFKDAVIYEVPVRAFADSDGDGIGDFCGLTQKLDYLQDLGVTAVWVLPF
FPSPLRDDGYDISDYTSVNPIYGNLEDFKAFLTAAHERGIRVIIELIINHTSDQHPWFQR
ARRSPAGSSERNFYVWSDTPEKYQDTRIIFKDFETSNWTWDPVAKAYYWHRFYSHQPDLN
FEHPELQQALFNVVDFWLEMGVDGLRLDAVPYLYEREGTNCENLPETHEFLKKLRRHVDE
KFPNRMLLAEANQWPEDAVEYYGQGDECHMDFHFPLMPRLYMALHMEDSFPIIDILQQTP
PIPDNCQWALFLRNHDELTLEMVSDEDRDYMYKVYAQDPQARINLGIRRRLAPLMGNNRR
RIELMNALLMSLPGTPVLYYGDEIGMGDNIYLGDRNGVRTPMQWSPDRNGGFSSANPQRL
YAPLIVDPEYHYEAVNVEAQRANPNSLWWWTKRLIATRGRYKAFGRGTFEFLYPENRKVL
AFTRNYNDEHILVVANLSRFVQTVELDLSAFNGMVPVEIFGRNAFPVISESPYFLSLGPH
AFYWFTLQMQPSLTCPIRNPNQIPKLIVSGRWQNVFAKGEARTALESILPDYLCSCAWFD
GKTRIIQATHITEAIPVSYENTQAYIILLRVDYTEGDPQTYVLTLAYETDGVGSERFSTH
IEQIVAQIYVQGKQETGVLFDALGQKDFLNIPLNAIAHHHTYEGMQGKLVATSTEHFSEI
LTQFSDQSSNVSLEPHLLKGEHTNTGIIYGDRLICKIFRKVEAGINPDLEIGY
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatccgattttgaaggacgatccgctttggtttaaagatgctgtaatctatgaa
gtgcctgtacgtgcttttgccgacagtgatggcgacggcattggcgatttttgtgggtta
acgcagaagttagattatctgcaagatttgggagtcacagcagtttgggtgctgcccttt
ttcccctcgccactgcgcgacgatggctacgacatttcagattacactagtgtcaacccc
atctacggtaatctagaagactttaaggcttttttaacagctgcccatgagcgcggaatt
cgcgtcattatagagttaatcatcaatcacacctccgatcaacacccttggtttcaacgg
gcaaggcgatcgcctgcgggcagttccgagagaaatttttacgtttggagtgacactcct
gaaaagtaccaggacacgcggatcatcttcaaggattttgaaacctctaactggacatgg
gatccggtagcaaaagcctattattggcatcgcttttattctcaccaaccagatttaaac
tttgaacacccagagttacagcaagcgctgtttaatgtggttgatttctggttagaaatg
ggggtcgatggactgcgtttagacgcagtgccttatctctatgaacgtgagggaactaac
tgtgagaatttaccagaaacccacgagtttttaaagaaattgcggcgacatgtagacgaa
aagttccccaaccggatgttactagcagaagcaaatcagtggcctgaggatgcggtagag
tattacggacaaggggatgagtgccacatggattttcactttcccctcatgccacgttta
tatatggcgttgcatatggaagatagcttcccgattattgacattttacagcagacgcca
ccaattcccgataactgccagtgggcgctatttttacgtaaccacgacgaactgactttg
gaaatggtcagtgatgaagaccgggattacatgtacaaagtttacgcccaagacccccaa
gcccggattaacttgggtattcgtcgccgtctcgcaccattgatgggtaataaccgccgc
cggattgagttgatgaatgctttgttaatgtctttaccaggaacacccgtattgtattac
ggcgatgagattggtatgggagacaatatttatttgggcgatcgcaatggtgtacgcacg
ccgatgcagtggagtcctgacagaaacggaggttttagtagtgctaatccccaaaggctt
tatgcccctttgattgtagacccagagtaccactacgaagcagtcaacgtagaagcacaa
cgggcaaaccccaattctctgtggtggtggactaaacgactaattgccaccagaggacgg
tataaagcttttggtcggggtacgtttgaatttttgtatccagaaaaccgcaaagtcctg
gcctttactcgcaactacaacgatgaacacattctcgttgtagctaatctctcgcggttt
gtgcagactgtggaattggatctgtctgcatttaatggcatggttccagtagaaattttt
ggtcgcaatgcttttccagtaatcagtgaatctccttacttccttagcttgggaccccat
gcattctattggtttaccctgcaaatgcaacccagcttgacttgtcccatccgcaatccc
aaccaaatacctaaacttatagtcagtggtagatggcagaatgtttttgccaaaggtgag
gcaagaacggcacttgaaagtatactgccagattatctgtgtagttgtgcttggttcgat
ggcaaaacacgcatcatccaagctacccacattacggaagcaattcctgtaagttatgaa
aatactcaagcgtatattattttactacgggtagactacacagaaggcgaccctcaaact
tatgttctcaccctggcttacgaaacagatggcgttggtagcgaacgcttcagcactcac
attgaacaaatagttgcccagatatatgtccagggtaaacaagaaaccggagtcttattt
gatgctttaggacaaaaagactttttgaatatccccttgaatgcgatcgctcatcatcat
acctacgaaggtatgcagggtaaattggtggcaacatccacagaacatttttcggaaatt
ctgactcagtttagtgaccaaagcagcaatgtttccttggaaccccatttactcaaaggc
gaacatactaacacaggcattatctatggcgatcgcctgatttgtaaaatcttccgcaaa
gtcgaggcgggtattaaccccgatctcgaaattgggtattaa

DBGET integrated database retrieval system