KEGG   Fischerella sp. NIES-3754: FIS3754_46770Help
Entry
FIS3754_46770     CDS       T04195                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
fis  Fischerella sp. NIES-3754
Pathway
fis00473  D-Alanine metabolism
fis00550  Peptidoglycan biosynthesis
fis01100  Metabolic pathways
fis01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fis00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    FIS3754_46770
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    FIS3754_46770
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    FIS3754_46770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fis01011]
    FIS3754_46770
Enzymes [BR:fis01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     FIS3754_46770
Peptidoglycan biosynthesis and degradation proteins [BR:fis01011]
 Precursor biosynthesis
  Amino acid ligase
   FIS3754_46770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 Helicase_C_3
Motif
Other DBs
NCBI-ProteinID: BAU08724
UniProt: A0A0S3TUK2
LinkDB All DBs
Position
complement(5398556..5399650)
Genome map
AA seq 364 aa AA seqDB search
MTKLRVGLLFGGCSGEHEVSITSARAIAKALSSGQNTSKYEILPFYIQKDGHWLAGDTPQ
QVLASGKPLSLPNSETVSSQSLSRWEFPPQVGKVDVWFPVLHGPNGEDGTVQGLLTLMQV
PFVGSGVLGSALGMDKIAMKMVFAQAGLPQVKYKAVNRSQIWSNPCVFPKLCDDIELTLG
YPCFIKPANLGSSVGIAKVRSRQELEAALDNAASYDRRIIVEAAVVARELECAVLGNDQP
KASVVGEITYKSEFYDYETKYTEGKADLVIPAAVPNAVTQQIQEMALQAFAAVDAAGLAR
VDFFYVEATGEVLINEINTLPGFTATSMYPLLWQHSGVSFPELVDQLIQLAVARYSSVEV
AASD
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagttgcgggtagggttgttatttggtggttgttccggcgaacatgaggtatcg
atcacctcagcaagagcgatcgcaaaagcattgagttcaggacaaaataccagtaaatat
gaaattttgcctttttacattcaaaaagatggacactggttggcaggagatacaccacaa
caagtcttagcatcaggaaaaccactgtcattgcctaactctgaaactgtaagttcccaa
tctctcagtcgttgggaatttcctccacaagttgggaaagtcgatgtttggtttcccgtt
ctacatggtcctaacggggaagatggtacagtgcagggtttactaactttaatgcaagtg
ccctttgtgggttctggagtgttaggttcagcactgggaatggataaaatagccatgaaa
atggtttttgcccaagctggattaccacaagttaaatacaaagcagtgaaccgttcccaa
atttggtcaaatccttgtgtttttcccaaactttgtgatgacattgaattaactttgggt
tatccctgtttcatcaaacctgcaaatttaggttcatcggtgggaattgccaaggtgcga
tcgcgtcaagaattagaagcagcattggataatgcagccagttatgatcgccgcatcatt
gtagaagcagcagtcgttgccagagaattagaatgtgctgttttaggaaacgatcaaccc
aaagcttcagtggtaggtgaaattacctataaaagtgaattttacgattatgaaactaaa
tatacagaaggtaaagcagatttagtcattcccgcagcagtgccaaatgcagttactcag
caaatccaggaaatggccttacaagcttttgcggctgttgatgctgccgggttggcgaga
gtagactttttctatgtagaagcaacaggcgaagtattgattaacgagattaacacccta
cccggctttacagccacaagtatgtatcccctactttggcaacacagtggtgtttctttc
ccagaactggttgatcaattaattcaactagctgttgcaaggtactcttctgtggaagta
gcagcatcagattag

DBGET integrated database retrieval system