KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_1109Help
Entry
BN1229_v1_1109    CDS       T03857                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00020  Citrate cycle (TCA cycle)
fiy00190  Oxidative phosphorylation
fiy00650  Butanoate metabolism
fiy01100  Metabolic pathways
fiy01110  Biosynthesis of secondary metabolites
fiy01120  Microbial metabolism in diverse environments
fiy01130  Biosynthesis of antibiotics
fiy01200  Carbon metabolism
Module
fiy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fiy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fiy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN1229_v1_1109 (sdhA)
   00650 Butanoate metabolism
    BN1229_v1_1109 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN1229_v1_1109 (sdhA)
Enzymes [BR:fiy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN1229_v1_1109 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BN1229_v1_1109 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: CPR17115
UniProt: A0A0D6JDI1
LinkDB All DBs
Position
1:1024319..1026169
Genome map
AA seq 616 aa AA seqDB search
MAGSATGSTKGDSMTAPAQGGKAYQIVDHTYDVVVVGAGGAGLRATLGCAEAGLKTACVT
KVFPTRSHTVAAQGGVAAALGNMGPDNWRWHMYDTVKGSDWLGDQDSIEYLCRHAPDAVY
ELEHYGVPFSRTESGKIYQRPFGGMTTQYGEGPPAQRTCAAADRTGHAMLHTLYGQSLRH
SAEFFIEFFAIDLIMDQEGACRGVIAIKLDDGTIHRFRAKKTILATGGYGRAYFSCTSAH
TCTGDGNAMVLRAGLPLQDMEFVQFHPTGIYGAGVLITEGARGEGGYLTNSEGERFMERY
APSAKDLASRDVVSRSMTVEIREGRGVGAHGDHIFLHLDHLDPKILAERLPGITESAKVF
AGVDLRRQPIPVIPTVHYNMGGIPTNYHGEVLTLKDGNPDYIVPGLMAIGEAACVSVHGA
NRLGSNSLIDLVVFGRAAGLRCADVVEPGAHADLPADSADLALSRLDHFRYAKGDTPTAD
LRLKMQRVMQSNCAVFRDGPVLEEGVHLIDEIWQQSGDIRVSDRSLVWNSDLVETMEYDN
LISQAAVTVTAAANRKESRGAHAREDYPNRDDANWMKHTLAWADLDARKVKLDFRPVHTY
TMTNEVSYIEPKARVY
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atggcgggatcggcaacaggctcaacgaaaggcgattcaatgacggcaccagcccagggt
ggcaaagcataccaaatcgttgatcacacctacgacgtcgtcgtcgtcggcgcgggtggc
gcgggtcttcgcgcgacactgggttgcgccgaggccggcttgaaaacggcctgtgtgacc
aaggtctttccgacgcgctcgcataccgtagctgcccaaggcggcgttgcagccgcgctc
ggaaacatgggaccggataattggcgctggcacatgtacgataccgtaaagggatcggat
tggcttggtgaccaggattccattgaatacctctgccggcatgcgccggatgctgtctat
gaactcgagcactacggcgtgccgttctcgcgcaccgagtccggcaagatttatcagcgg
ccttttggcggtatgacgacgcaatacggtgagggtccgccggcccagcgcacctgcgct
gctgccgaccgcaccggccacgccatgcttcacacgctttatggtcagagcctccggcac
tcggcggagttcttcatcgaatttttcgccatcgacttgatcatggatcaagaaggggca
tgccgcggcgtcatcgcgataaagctagacgacggcacgatccatcgtttccgcgcgaag
aaaacaatcttagcgactggcggttatggccgcgcctacttctcctgtacctctgcgcac
acgtgcacgggtgacggcaacgctatggtgttgcgcgctggcctgccgctgcaggatatg
gagttcgtgcagttccacccgacggggatatacggagctggcgtgctgatcaccgaaggc
gcgcgcggcgagggtggttacctaaccaactcggaaggcgaacgcttcatggagcgttat
gcgccatccgcgaaggatctggcgtcacgcgacgtcgtctcgcgctcgatgaccgttgaa
atccgcgaaggccgcggtgtcggggcgcatggcgatcacatcttcctgcatctcgaccat
ctcgatccgaagattttggctgagcgtctgcccggcattaccgaaagcgcgaaggttttc
gcaggggttgatctgcgtcgtcagccgatcccggtaattccgacggtgcactacaacatg
ggcggcatcccgacgaactatcacggtgaagtcctgaccctgaaggatggcaatcccgac
tacattgtcccaggtctgatggccatcggcgaggcggcttgcgtctccgtccatggcgca
aatcggcttgggtcgaactctctcatcgatttggtcgtgttcggacgtgccgcggggctt
cgctgcgctgatgtagtcgagccgggtgcccatgctgacctgcctgcggactctgcggat
cttgcactctcccgtctggatcacttccgctacgccaagggcgacacgccaacggctgat
ctgcgcctgaagatgcagagggtgatgcagtctaactgcgcggtgttccgcgacggtccg
gtactcgaagagggcgtgcatctgatcgacgagatctggcagcagtcaggcgatatccgc
gtctccgacagatctctagtctggaactcggacttggttgagacgatggagtacgacaac
ctcatcagccaggcggccgtcaccgtaactgccgcggccaaccgcaaagaaagccgcggt
gcgcacgcgcgtgaggactatcccaaccgcgatgacgccaactggatgaagcacacgttg
gcttgggctgacctcgacgcccgtaaggtcaaactcgacttccgtccggtccacacctac
accatgaccaatgaagtctcgtatatcgagccgaaagcgcgcgtctactga

DBGET integrated database retrieval system