KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_1114Help
Entry
BN1229_v1_1114    CDS       T03857                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, FeS subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00020  Citrate cycle (TCA cycle)
fiy00190  Oxidative phosphorylation
fiy00650  Butanoate metabolism
fiy01100  Metabolic pathways
fiy01110  Biosynthesis of secondary metabolites
fiy01120  Microbial metabolism in diverse environments
fiy01130  Biosynthesis of antibiotics
fiy01200  Carbon metabolism
Module
fiy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fiy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
fiy_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BN1229_v1_1114 (sdhB)
   00650 Butanoate metabolism
    BN1229_v1_1114 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BN1229_v1_1114 (sdhB)
Enzymes [BR:fiy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BN1229_v1_1114 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BN1229_v1_1114 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_10 Fer4_8 Fer4_7 Fer2 Fer4_9
Motif
Other DBs
NCBI-ProteinID: CPR17126
UniProt: A0A0D6JDI6
LinkDB All DBs
Position
1:1028281..1029111
Genome map
AA seq 276 aa AA seqDB search
MSLLIHFRCSATETDGSMVQLTLPRNSTVKSGKVWNSPQSSGRWKEFRIYRWSPDDGENP
RIDIYWLDQDQCGPMVLDGLIKIKNEIDQTLTFRRSCREGICGSCSMNIDGTNTLACLKA
IDDVKGAIKIYPLPHMQVIKDLVPDMTHFYAQHRSIEPWLKTETPTPPTEWKQSRDDREK
LDGLYECILCACCSASCPSYWWNSDRYLGPAILLQAYRWINDSRDEATGERLDNIEDPFR
LYRCHTILNCTQACPKGLNPAKAIAELKKLMVERRV
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgcttatccattttagatgcagtgcaacagaaactgacggctcaatggtccag
ctcacgctccctcgcaattcgacggtaaaatctggcaaggtttggaactcaccccaaagc
tcggggcgctggaaagagttccgcatttataggtggagtccggatgacggggaaaatccc
cgcatcgacatctactggcttgaccaggatcagtgcgggccgatggttctcgacgggctc
atcaagatcaagaatgagattgatcagaccttgacgttccgcaggtcgtgccgcgaaggc
atctgcggctcctgctctatgaacattgatggcaccaacacgctggcctgtctcaaagcg
atcgacgatgtaaagggcgcgatcaagatctatccattgccgcacatgcaagtcatcaag
gacttggtgccggatatgacccacttctatgcgcagcatcgctcgattgagccctggttg
aaaacagaaaccccaactccgccgacagagtggaagcaatcgcgggacgatcgcgagaaa
ctggacggtctgtatgagtgtattctgtgtgcgtgctgctcggcgtcatgcccaagctat
tggtggaactcggatcgctatctcggcccagcgatactcctgcaagcctaccgttggatc
aacgatagccgcgatgaagcaaccggagagcgtttggacaatatcgaggacccattccgg
ctctaccgatgccacaccattttgaactgcacccaggcgtgcccaaaaggcttgaatcca
gccaaagccatcgctgaactgaagaaattgatggttgagcgtcgcgtttag

DBGET integrated database retrieval system