KEGG   Candidatus Filomicrobium marinum Y: BN1229_v1_1931Help
Entry
BN1229_v1_1931    CDS       T03857                                 

Definition
(GenBank) Gst15 protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fiy  Candidatus Filomicrobium marinum Y
Pathway
fiy00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fiy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BN1229_v1_1931
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fiy02000]
    BN1229_v1_1931
Enzymes [BR:fiy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     BN1229_v1_1931
Transporters [BR:fiy02000]
 Other Transporters
  Pores ion channels [TC:1]
   BN1229_v1_1931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C_3
Motif
Other DBs
NCBI-ProteinID: CPR18936
UniProt: A0A0D6JEU7
LinkDB All DBs
Position
1:complement(1876490..1877128)
Genome map
AA seq 212 aa AA seqDB search
MDGNSSDLIHYHAPRTRSGAIRWLFAELDVPHDLKLMNLAKGDHKTPEFLGINPMGKVPT
VVHKGVVITEAPAICAYLADAFPAAGLAPATDDPARGRYFRALFFYSGCVEPAAGDRALK
REPGPSSQVGYGTFESMIEGLKDIIGSGPYILGERFTAADVMLGAGVGYLSDFGLLPKDP
VLSSYVARVRARPKYARTTAEEETLLAKLAAE
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggatgggaatagcagtgatttaatccattaccatgccccgcgaacccgatcgggggcg
atccgttggctgttcgcagaactggacgtcccgcacgacctcaagctgatgaatctggcc
aaaggagaccataagacgccagagttcctgggcatcaatccgatgggcaaggtgcccacc
gtggttcacaagggggttgttattaccgaggccccagcaatctgtgcttatctcgctgat
gcgtttccggctgccggcttagcacctgctacggatgatccggcacggggccgctatttt
agagccctgttcttctattcgggttgtgtcgaaccggccgctggggatcgtgcgttgaag
cgtgagccgggaccttctagccaagtcggctatggcacatttgaatcgatgatcgaggga
ctgaaagacattatcggttcaggcccctacatcttgggcgagcgttttacggctgccgac
gtcatgcttggcgcgggtgttggatacctaagcgacttcgggctgcttcctaaggatccc
gttttgagcagctacgttgcgcgcgttcgtgcacggccgaagtatgcccgcaccacggcg
gaagaagaaacgttgttggcaaagctcgcggctgagtga

DBGET integrated database retrieval system