KEGG   Flavobacterium anhuiense: BB050_01305Help
Entry
BB050_01305       CDS       T04718                                 

Gene name
alr
Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
fjg  Flavobacterium anhuiense
Pathway
fjg00473  D-Alanine metabolism
fjg01100  Metabolic pathways
fjg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:fjg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BB050_01305 (alr)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    BB050_01305 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:fjg01011]
    BB050_01305 (alr)
Enzymes [BR:fjg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BB050_01305 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:fjg01011]
 Precursor biosynthesis
  Racemase
   BB050_01305 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AOC94436
LinkDB All DBs
Position
complement(1514833..1517274)
Genome map
AA seq 813 aa AA seqDB search
MLNAKWTGSNAAILIDHISIDSRSLQNGSQTLFFALAGVNNDAHSFIPDLIENNVRNFVV
QYIPEGYADKANFLVVENTLLALQGFAAYYRSLFHFPVIGLTGSNGKTIVKEWLNFLLSP
DYNIIRSPKSYNSQVGVPLSVIGINEKHNLGIFEAGISTVNEMVKLEKIIKPTIGVLTNI
GSAHDEGFLNLVQKIDEKLLLFKDCSIIIYQKTEVVESCLTQFAAEYMIHPRKLFSWSFT
DKKADVFIEKREYKNDHTFIQYHYQNETFNLEVPFNDSASIENTISCLLVLLHLNYDQET
IQSRIQMLYPIRMRLEVKNGINNCSIIDDSYSSDFQSLKIALDFLESQKKKGASKTVILS
DIFQSGFTNEELYSKVAQLISDNKINRIIGIGPIISSFAAKFPNSTMFENTSNFIAAIDD
FNFHNETILIKGARSFEFEEIVSLLEEKTHETILEINLDAISHNFNYYKSKLAPGIKMMV
MVKAFGYGNGGLEIAKLLEHHKVDYLGVAFADEGISLKNGGIKVPIMVLNPESTSFPSMI
QYQLEPEIYSLKGLNAFLKIAREKNLKDYPIHIKMDTGMHRLGFENNTIDELIATLKGNS
TVRVQSILSHLATSDESKHFDFVRQQIALFEKLSSKLISELNINPIRHILNTSGISNFPD
AQYSMVRLGIGLYGVSNDPAEQKYLENVGTLKSIISQIRTIPAGDSVGYGRRFMADRETK
IATIPIGYADGISRLWGNEVGYVTIKNQKAKIVGSVCMDMLMVNVSHIDCKEGDSVIIFG
ESPTVIEMAVALKTIPYEIMTSISQRVKRVFFR
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaatgccaaatggactggctcaaatgctgctattttaatagatcatatttcaatt
gacagccgttcgcttcaaaacggatcgcaaaccttattttttgctttggccggtgttaat
aacgatgctcattcttttattcccgatttaatagaaaacaatgttcggaattttgttgtt
caatatattccagagggttacgctgataaagctaattttttggtagtcgaaaatacgctt
cttgcacttcagggatttgcagcctattacagaagtcttttccattttccggttattgga
ttaacaggaagcaacggtaaaaccattgtaaaagaatggcttaattttttattaagtcct
gactataatattattagaagtccaaaaagttataattctcaagttggagttcctctttcg
gtaattggaattaatgaaaaacataatttaggcattttcgaagctggaatttcgacagtt
aatgaaatggttaaactggagaaaatcattaaaccaacaataggtgtactcaccaatatt
ggaagtgcgcatgatgaaggctttttgaatttagtacaaaagattgatgaaaaattgctt
ttgtttaaagactgttcgatcattatttatcaaaaaacagaggttgtagaatcatgcctg
actcagtttgccgcagaatatatgattcatccgcgaaagcttttttcatggagttttaca
gataaaaaagctgatgtttttattgaaaaacgagaatataaaaacgaccatacttttatt
caataccattatcaaaatgaaactttcaatttagaagttccgtttaacgattcagcttct
atagaaaatacaatttcatgtttattggttttactgcatcttaattacgatcaggagaca
atccaaagtcgaatccagatgctgtacccaattcgaatgcgtttggaagtgaaaaacgga
attaataattgcagtattattgacgatagttacagttccgattttcagtcgcttaaaatt
gctttagatttcttggaaagccagaagaaaaaaggagcttcaaaaacagtcattctatca
gatatttttcagagcgggtttacaaatgaagaattatattctaaagtagctcagttaatt
tcagacaataaaattaatcgtataattggtattggaccaataatatcttcttttgcagct
aagtttccaaatagtactatgtttgaaaacacaagcaattttattgctgcaatcgatgat
tttaatttccacaatgaaacgattttaataaaaggagcaagatcttttgaatttgaagaa
atcgtttcgttgctagaagagaaaacccatgaaaccattctagagataaatttagatgcc
atcagccataattttaattactataaatcgaaattggcaccaggtatcaaaatgatggtt
atggtaaaagcatttggctacggaaatggaggtttagaaattgctaaacttttggagcat
cataaagttgattatttgggtgtggctttcgccgacgaaggaatatcgctaaaaaatggc
ggcataaaagtgccaattatggttttgaatccagaatcgacgagttttccatctatgatt
cagtatcagctagaacctgaaatttatagcttgaaaggactgaatgcctttttaaaaatt
gctcgtgaaaagaatttaaaagattatccaattcatatcaaaatggatacgggaatgcat
cgtttaggttttgaaaataatacaatcgatgagctgattgcgactttaaagggcaattcg
acagttcgtgttcagagtattttatcgcatttggcgacaagtgacgaatcaaaacatttt
gattttgtaagacagcagattgctttgttcgaaaaactttcttcaaaattgatatcagaa
ttaaatatcaatccaattcgacatattttgaatacttcgggaattagcaattttcctgat
gcacaatacagtatggttcgtttaggaattggtttgtatggtgtttcaaacgatcctgca
gaacagaaatatttggaaaatgttggaactctgaaatctataatttctcaaattaggacc
attcctgcaggcgacagcgtaggttacggacgtcgttttatggcagaccgagaaaccaaa
attgcgacgatcccaattggttacgcagatggaatttcgagattatggggaaatgaagtt
gggtatgtaaccattaaaaatcaaaaagcaaaaattgtaggcagtgtctgcatggatatg
ctgatggttaatgtaagtcatatagattgcaaagaaggcgattcggtaattatttttggc
gaaagtccgactgtgatagagatggctgtagccttaaaaacaattccatatgagatcatg
acgagtatttcgcagcgcgttaagagggtattttttagataa

DBGET integrated database retrieval system