KEGG   Flavobacterium johnsoniae GSE09: BB050_01401Help
Entry
BB050_01401       CDS       T04718                                 

Gene name
gabD_1
Definition
(GenBank) Succinate-semialdehyde dehydrogenase [NADP(+)]
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fjg  Flavobacterium johnsoniae GSE09
Pathway
fjg00010  Glycolysis / Gluconeogenesis
fjg00053  Ascorbate and aldarate metabolism
fjg00071  Fatty acid degradation
fjg00280  Valine, leucine and isoleucine degradation
fjg00310  Lysine degradation
fjg00330  Arginine and proline metabolism
fjg00340  Histidine metabolism
fjg00380  Tryptophan metabolism
fjg00410  beta-Alanine metabolism
fjg00561  Glycerolipid metabolism
fjg00620  Pyruvate metabolism
fjg00625  Chloroalkane and chloroalkene degradation
fjg01100  Metabolic pathways
fjg01110  Biosynthesis of secondary metabolites
fjg01120  Microbial metabolism in diverse environments
fjg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fjg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BB050_01401 (gabD_1)
   00053 Ascorbate and aldarate metabolism
    BB050_01401 (gabD_1)
   00620 Pyruvate metabolism
    BB050_01401 (gabD_1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BB050_01401 (gabD_1)
   00561 Glycerolipid metabolism
    BB050_01401 (gabD_1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BB050_01401 (gabD_1)
   00310 Lysine degradation
    BB050_01401 (gabD_1)
   00330 Arginine and proline metabolism
    BB050_01401 (gabD_1)
   00340 Histidine metabolism
    BB050_01401 (gabD_1)
   00380 Tryptophan metabolism
    BB050_01401 (gabD_1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BB050_01401 (gabD_1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BB050_01401 (gabD_1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BB050_01401 (gabD_1)
Enzymes [BR:fjg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BB050_01401 (gabD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOC94531
LinkDB All DBs
Position
complement(1623151..1624704)
Genome map
AA seq 517 aa AA seqDB search
MTTIASQFGMKEALEKLGIKTINEGTSTGINNFSSGEILESYSPVDGKLIASVKMSTAED
YEKAIQSAAEAFKTFRLIPAPQRGEIVRQFGEKLRQNKEALGKLVSYEMGKSFQEGLGEV
QEMIDICDFAVGLSRQLHGLTMHSERPGHRMYEQYHPLGIVGIISAFNFPVAVWSWNTAL
AWISGDVCVWKPSEKTPLCGIACQNIIAQVIKENNLPEGISCLINGDYKIGELLTADTRI
PLISATGSTRMGKIVAQTVAGRLGKSLLELGGNNAIIVTPDADIKMTVIGAVFGAVGTAG
QRCTSTRRLIIHESIYDKVKDALVAAYKQLRIGNPLDENNHVGPLIDTHAVEMYAAALNK
VVAEGGKILVEGGVLSGQGYESGCYVKPAIAEAENSFDIVQHETFAPVLYLIKYSGEVEN
AIEIQNGVAQGLSSAIMTNNLREAERFLSATGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKIYMRRQTNTINYTTNLPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatagcatcgcaatttggaatgaaggaagctcttgaaaaattgggcatcaag
acaataaatgaaggaacatcaacaggaattaataatttttcatctggagaaattctagaa
agttattcgccagttgacggaaaattaattgcttcggtaaaaatgtcaacagcagaagat
tatgaaaaagcaatccagagtgctgcagaagcgtttaaaacttttagattaattcctgcg
ccacagcgtggtgaaattgtacgtcagtttggagaaaaattgagacaaaataaagaagct
cttgggaaactggtttcttacgaaatgggaaaatcatttcaagagggtcttggagaagtt
caggaaatgattgatatctgtgattttgcagttggtttatctcgtcagcttcacggatta
acaatgcattctgaaagaccaggacaccgtatgtatgagcaatatcatccgttgggaatt
gttggaatcatttcggcctttaattttccagttgcagtttggtcttggaatactgcttta
gcttggatttctggagatgtctgtgtttggaaaccttctgaaaaaacacctctttgcggt
attgcttgccagaatattatagctcaggttattaaagaaaacaatcttccagaaggaatt
tcatgtttgataaacggtgattataaaataggagagttattgactgctgatactcgaatt
ccgcttatttctgcgacaggttcaaccagaatgggaaaaattgttgctcagactgtggca
ggaagattaggcaaatcattattagaacttggaggaaacaatgctattattgtgactcct
gatgccgatattaaaatgaccgttatcggagctgttttcggagctgttggaacggctgga
caacgttgtacttcaactagaagactgattattcatgagagtatttatgataaagtaaaa
gatgcattggtggcagcttacaaacagttaagaatcggaaatcctcttgacgaaaacaat
catgttggtcccctaattgacactcacgcagtggaaatgtatgcagcggctttaaataaa
gttgtagccgaaggcggaaaaattttagttgaaggaggagtgctttctggacaaggttat
gaaagtggctgttatgttaaacctgcgattgctgaagctgaaaattcatttgatattgtt
cagcatgaaacttttgcacctgttttatatttaattaaatattcaggcgaagtagagaat
gcaatcgaaattcagaatggtgttgcgcaaggattgtcttctgcaattatgacgaataat
ttgcgtgaagcagaaagatttttatctgctacaggttcagactgtggaattgcaaacgta
aatatcggaacttctggagcagaaattggcggagcttttggtggtgaaaaagaaacagga
ggcggacgtgaatcagggtctgatgcttggaaaatttatatgagacgtcaaactaataca
atcaattatactacaaatcttccattagcgcagggaattaaatttgatttgtaa

DBGET integrated database retrieval system