KEGG   Flavobacterium anhuiense: BB050_02682Help
Entry
BB050_02682       CDS       T04718                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
fjg  Flavobacterium anhuiense
Pathway
fjg00564  Glycerophospholipid metabolism
fjg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fjg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BB050_02682 (glpD)
Enzymes [BR:fjg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BB050_02682 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA HI0933_like Thi4 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AOC95777
LinkDB All DBs
Position
complement(3004350..3005927)
Genome map
AA seq 525 aa AA seqDB search
MNRSEQLTKLDNTEKWDVIIIGGGASGLGTAVDAASRGYKTVLFEAVDFAKGTSSRSTKL
VHGGVRYLAQGDVHLVREALKERGLLAQNAAHLVKNQSFVIPNYHLLSGYFYTIGLKIYD
LLSGFLSLGSSKYLSKKKTIEMLPNVEEKGLVNGVIYHDGQFDDSRLAINLAQTAVENGA
CLLNYIKVTNLLKDDKNQIIGVQVQDQESGINYDIKGSAVINATGVFTNAIMKLNETVYK
KYIVPSQGIHLVLDKSFLPGENALMIPKTKDGRVLFAVPWHNRIVVGTTDTLIKKQSLEP
IALESEIQFVLETAQRFLAKKPERKDVLSVFAGLRPLAAPKEEGKSTKEVSRSHKIIVSE
TGLITITGGKWTTYRKIAEDIIDKAIKTGKLEKKECRTEHLSIHGNQPTNAADRENHLYI
YGTDIPKIIELQEREPELKEKLHPNHEFTMAEVVWAIRYEMARTVDDILARRVRLLFLDA
RAAIEVSEKTARVLAKELGHNEAWIHSEISNFRQIAKGFLLSEFR
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgctccgagcaattaaccaaactagacaataccgaaaaatgggacgtaataata
attggcggaggtgcaagcggtctcgggacggcagttgatgcagcaagtcgtggttataaa
accgttttatttgaagctgtagattttgcaaaaggaacttctagcagaagcaccaaattg
gttcatggcggtgtacgttatttagctcaaggagatgtgcatttagttagagaagcatta
aaagaacgaggcttattagcgcaaaacgcagctcatttagtgaaaaaccaatcgtttgta
attccgaattatcatttattgagcggttatttttatacaatcggattaaaaatttatgat
ttattgtcaggctttttaagtttaggaagttctaaatatctttcaaaaaagaaaactatc
gaaatgcttccaaacgttgaggaaaaaggtttggtcaatggcgttatttatcatgatggt
caatttgatgattctcgtctggctataaatcttgctcaaacggccgtagaaaatggagct
tgtcttttaaattatataaaagttaccaatttattaaaagacgacaaaaaccaaattatt
ggcgttcaggttcaagatcaagaaagcggaattaactatgatataaaaggttctgctgta
ataaatgcaactggagtttttacaaacgccatcatgaaattaaatgagacggtttataaa
aaatatattgttccaagtcagggaattcatttggtacttgataaatcttttttgccaggc
gaaaatgctttaatgattccaaaaacaaaagacggaagagttttattcgctgttccgtgg
cacaaccgaattgtagttggaacaaccgatactttaataaagaaacaaagtttagaacct
attgctttagaaagcgaaattcaatttgttttggaaaccgcacaaagattcttggcaaaa
aagccagaaagaaaagatgtattatctgtttttgctggattgcgtccgttagctgcaccg
aaagaagaaggcaaaagcaccaaagaagtttccagaagccataaaattatagtttctgaa
acgggtcttattaccattactggaggaaaatggacaacctacagaaaaattgctgaggat
attattgataaagccatcaaaactggcaaattagaaaagaaagaatgccgtacagagcat
ctttcaattcatggaaatcagccaacgaatgctgcagacagagaaaatcacctttatata
tatggtactgatattccgaaaataattgaattacaggaaagagaacctgagctaaaagaa
aagctgcatcctaatcatgaatttacaatggcagaagtcgtttgggctattcgatacgaa
atggcacgaacggtagacgatattttagccagacgagttcgcttattatttttagatgct
agagctgcaattgaagtttcggagaaaaccgctagagtacttgccaaagaattaggacac
aatgaagcgtggatacactcagaaatttccaattttagacaaattgcgaagggttttctt
ttgtcagaattccgataa

DBGET integrated database retrieval system